Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Membrane protein insertase YidC 2 (yidC2)

This Recombinant Membrane protein insertase YidC 2 (yidC2) spans the amino acid sequence from region 24-310.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC 2, Foldase YidC 2, Membrane integrase YidC 2, Membrane protein YidC 2

UniProt

Q8E3U9

Expression Region

24-310

Origin

Streptococcus agalactiae serotype III

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CVSVDKAGKPYGVIWNTLGVPMANLITYFAQHQGLGFGVAIIIVTIIVRVIILPLGLYQS WKASYQAEKMAYFKPLFEPINERLRNAKTQEEKLAAQTELMTAQRENGLSMFGGIGCLPL LIQMPFFSAIFFAARYTPGVSSATFLGLNLGQKSLTLTVIIAILYFVQSWLSMQGVPDEQ RQQMKTMMYVMPIAMVFMSISLPASVALYWFIGGIFSIIQQLVTTYVLKPKLRRKVEEEY TKNPPKAYKSNNARKDVTSSTKTTESNQAIITSKKTNRNAGKQKRRG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ViaFluor® 405 Live Cell Microtubule Stain
#70064-T 1 Kit

ViaFluor® 405 Live Cell Microtubule Stain

Sign In for Pricing
View Details
NUDT18 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6B7]
TA503864AM 100 µL

NUDT18 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6B7]

Sign In for Pricing
View Details
Aceclofenac Acyl-beta-D-glucuronide
TRC-A130405-50MG 50 mg

Aceclofenac Acyl-beta-D-glucuronide

Sign In for Pricing
View Details
Lumiflavin
TRC-L473900-5MG 5 mg

Lumiflavin

Sign In for Pricing
View Details
CCDC169 (NM_001144981) Human Over-expression Lysate
LC428621 20 µg

CCDC169 (NM_001144981) Human Over-expression Lysate

Sign In for Pricing
View Details
Chromogranin A (PHE5), CF405S conjugate, 0.1mg/mL
BNC040461-500 1x 500 µL

Chromogranin A (PHE5), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details