Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Membrane protein insertase YidC 2 (yidC2)

This Recombinant Membrane protein insertase YidC 2 (yidC2) spans the amino acid sequence from region 24-310.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC 2, Foldase YidC 2, Membrane integrase YidC 2, Membrane protein YidC 2

UniProt

Q8E3U9

Expression Region

24-310

Origin

Streptococcus agalactiae serotype III

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CVSVDKAGKPYGVIWNTLGVPMANLITYFAQHQGLGFGVAIIIVTIIVRVIILPLGLYQS WKASYQAEKMAYFKPLFEPINERLRNAKTQEEKLAAQTELMTAQRENGLSMFGGIGCLPL LIQMPFFSAIFFAARYTPGVSSATFLGLNLGQKSLTLTVIIAILYFVQSWLSMQGVPDEQ RQQMKTMMYVMPIAMVFMSISLPASVALYWFIGGIFSIIQQLVTTYVLKPKLRRKVEEEY TKNPPKAYKSNNARKDVTSSTKTTESNQAIITSKKTNRNAGKQKRRG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chlorguanide-d6 Hydrochloride
TRC-C329503-1MG 1 mg

Chlorguanide-d6 Hydrochloride

Sign In for Pricing
View Details
TCL1 (T-Cell Marker) (TCL1/2747R), CF647 conjugate, 0.1mg/mL
BNC472747-500 1x 500 µL

TCL1 (T-Cell Marker) (TCL1/2747R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
D-Threonic Acid Calcium Salt
TRC-D234350-5MG 5 mg

D-Threonic Acid Calcium Salt

Sign In for Pricing
View Details
RNA5-8SN2 Mouse Monoclonal Antibody [Clone ID: OTI1C8]
CF811327 100 µg

RNA5-8SN2 Mouse Monoclonal Antibody [Clone ID: OTI1C8]

Sign In for Pricing
View Details
Human ERMAP activation kit by CRISPRa
GA114440 1 Kit

Human ERMAP activation kit by CRISPRa

Sign In for Pricing
View Details
MASPIN (SERPINB5) Mouse Monoclonal Antibody [Clone ID: AT2N6]
AM09353PU-N 100 µL

MASPIN (SERPINB5) Mouse Monoclonal Antibody [Clone ID: AT2N6]

Sign In for Pricing
View Details