Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Membrane protein insertase YidC 2 (yidC2)

This Recombinant Membrane protein insertase YidC 2 (yidC2) spans the amino acid sequence from region 24-310.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC 2, Foldase YidC 2, Membrane integrase YidC 2, Membrane protein YidC 2

UniProt

Q8E3U9

Expression Region

24-310

Origin

Streptococcus agalactiae serotype III

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CVSVDKAGKPYGVIWNTLGVPMANLITYFAQHQGLGFGVAIIIVTIIVRVIILPLGLYQS WKASYQAEKMAYFKPLFEPINERLRNAKTQEEKLAAQTELMTAQRENGLSMFGGIGCLPL LIQMPFFSAIFFAARYTPGVSSATFLGLNLGQKSLTLTVIIAILYFVQSWLSMQGVPDEQ RQQMKTMMYVMPIAMVFMSISLPASVALYWFIGGIFSIIQQLVTTYVLKPKLRRKVEEEY TKNPPKAYKSNNARKDVTSSTKTTESNQAIITSKKTNRNAGKQKRRG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human DYNLT3 activation kit by CRISPRa
GA104806 1 Kit

Human DYNLT3 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Mouse SynCam/CADM1 Protein (aa 48-388, His Tag)
PKSM041349-01 10 µg

Recombinant Mouse SynCam/CADM1 Protein (aa 48-388, His Tag)

Sign In for Pricing
View Details
Recombinant Mouse SynCam/CADM1 Protein (aa 48-388, His Tag)
PKSM041349-02 50 µg

Recombinant Mouse SynCam/CADM1 Protein (aa 48-388, His Tag)

Sign In for Pricing
View Details
Nucleolin (NCL/902), Biotin conjugate, 0.1mg/mL
BNCB0902-100 1x 100 µL

Nucleolin (NCL/902), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CCDC69 (NM_015621) Human Recombinant Protein
TP317758M 100 µg

CCDC69 (NM_015621) Human Recombinant Protein

Sign In for Pricing
View Details
PGM1 (NM_002633) Human Over-expression Lysate
LY419204 100 µg

PGM1 (NM_002633) Human Over-expression Lysate

Sign In for Pricing
View Details