Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shewanella oneidensis Protease HtpX (htpX)

This Recombinant Shewanella oneidensis Protease HtpX (htpX) spans the amino acid sequence from region 1-287.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

Q8EDL5

Expression Region

1-287

Origin

Shewanella oneidensis (strain MR-1)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKRIFLLIVTNLAVLLVASIVMSILGVNTSTMGGLLVFAAIFGFGGAFISLAISKWMAKK TMGCEVITTPRDSTERWLLDTVARQAQQAGIKMPEVAIYQSPEMNAFATGPSKDNSLVAV STGLLYGMSQDEIEGVLAHEVSHVANGDMVTLTLIQGVVNTFVIFAARVVAGIINNFVSS NDEEGEGLGMFAYMAVVFVLDMLFGILASIIVAYFSRIREYRADEGAARLAGKNKMIAAL ERLRQGPESSAMPAQMSAFGINGKRSMAELMMSHPPLEKRIAALQSR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Abpa CRISPRa sgRNA lentivector (set of three targets)(Rat)
11115126 3x 1.0µg DNA

Abpa CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
UACA / Nucling (UACA/1222), CF647 conjugate, 0.1mg/mL
BNC471222-100 1x 100 µL

UACA / Nucling (UACA/1222), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Rps9 ORF Vector (Rat) (pORF)
ORF075635 1.0 µg DNA

Rps9 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Hspa13 3'UTR Lenti-reporter-Luc Vector
23996084 1.0 µg

Hspa13 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
2-[2-Chloro-5- (trifluoromethyl) phenyl]-4,4,5,5-tetramethyl-1,3,2-dioxaborolane
WVB21495 10 g

2-[2-Chloro-5- (trifluoromethyl) phenyl]-4,4,5,5-tetramethyl-1,3,2-dioxaborolane

Sign In for Pricing
View Details
AMMONIA127X33RL-T2-P21 Pipe Markers for Acids & Bases
N003682 505 Roll (505 Marker (s) x 1 Roll)

AMMONIA127X33RL-T2-P21 Pipe Markers for Acids & Bases

Sign In for Pricing
View Details