Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shewanella oneidensis Protease HtpX (htpX)

This Recombinant Shewanella oneidensis Protease HtpX (htpX) spans the amino acid sequence from region 1-287.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

Q8EDL5

Expression Region

1-287

Origin

Shewanella oneidensis (strain MR-1)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKRIFLLIVTNLAVLLVASIVMSILGVNTSTMGGLLVFAAIFGFGGAFISLAISKWMAKK TMGCEVITTPRDSTERWLLDTVARQAQQAGIKMPEVAIYQSPEMNAFATGPSKDNSLVAV STGLLYGMSQDEIEGVLAHEVSHVANGDMVTLTLIQGVVNTFVIFAARVVAGIINNFVSS NDEEGEGLGMFAYMAVVFVLDMLFGILASIIVAYFSRIREYRADEGAARLAGKNKMIAAL ERLRQGPESSAMPAQMSAFGINGKRSMAELMMSHPPLEKRIAALQSR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5- (3-Hydroxyphenyl) -1H-pyrazole-3-carboxylic acid
OR13182-01 250 mg

5- (3-Hydroxyphenyl) -1H-pyrazole-3-carboxylic acid

Sign In for Pricing
View Details
5- (3-Hydroxyphenyl) -1H-pyrazole-3-carboxylic acid
OR13182-02 1 g

5- (3-Hydroxyphenyl) -1H-pyrazole-3-carboxylic acid

Sign In for Pricing
View Details
APC anti-mouse CD48
GT00963 25 µg

APC anti-mouse CD48

Sign In for Pricing
View Details
Itga10 sgRNA CRISPR Lentivector (Rat) (Target 1)
K6734602 1.0 µg DNA

Itga10 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
FCHSD1 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
20396124 3x 1.0µg DNA

FCHSD1 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
PTP4A2, ID (Protein Tyrosine Phosphatase Type IVA 2, Protein-tyrosine Phosphatase 4a2, Protein-tyrosine Phosphatase Of Regenerating Liver 2, PRL-2, PTP(CAAXII), HU-PP-1, OV-1, BM-008, PTPCAAX2, PRL2) (APC)
MBS6495841-01 0.2 mL

PTP4A2, ID (Protein Tyrosine Phosphatase Type IVA 2, Protein-tyrosine Phosphatase 4a2, Protein-tyrosine Phosphatase Of Regenerating Liver 2, PRL-2, PTP(CAAXII), HU-PP-1, OV-1, BM-008, PTPCAAX2, PRL2) (APC)

Sign In for Pricing
View Details