Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Membrane protein insertase YidC 2 (yidC2)

This Recombinant Membrane protein insertase YidC 2 (yidC2) spans the amino acid sequence from region 24-310.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC 2, Foldase YidC 2, Membrane integrase YidC 2, Membrane protein YidC 2

UniProt

Q8DSP8

Expression Region

24-310

Origin

Streptococcus mutans

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CVQMKNGKPTGEGWVYKFFAAPMGSVIQYLANNLGLGFGFAIIIVTVIVRLLILPLGLSQ VRKMTYQSEKMAYLKPVFDPIQERMKNAKTQEEKMAAQTELMQAQRHYGMSMFGGLGCLP LLIQMPFFSALYISTRYTKGIASASFLGIKLGSPNMIITVIIGILYLVQSWVSTLSVPEA QRQQTRNMMFMMPIMMVMISIGAPAGGALYWLVSGIFGLIQQLITNHIIKPKLRKQIDEE FKKNPPKPFKSNARKDITPQANNDKKLITSKKQKSNRNAGKQRHHKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Actin, ID (Actin, cytoplasmic 1, Beta-actin, Actin, alpha cardiac muscle 1, Alpha-cardiac actin, ACTC1, ACTB/ACTC) (FITC)
MBS6461194-01 0.2 mL

Actin, ID (Actin, cytoplasmic 1, Beta-actin, Actin, alpha cardiac muscle 1, Alpha-cardiac actin, ACTC1, ACTB/ACTC) (FITC)

Sign In for Pricing
View Details
Actin, ID (Actin, cytoplasmic 1, Beta-actin, Actin, alpha cardiac muscle 1, Alpha-cardiac actin, ACTC1, ACTB/ACTC) (FITC)
MBS6461194-02 5x 0.2 mL

Actin, ID (Actin, cytoplasmic 1, Beta-actin, Actin, alpha cardiac muscle 1, Alpha-cardiac actin, ACTC1, ACTB/ACTC) (FITC)

Sign In for Pricing
View Details
(all-Z) -6,9,12,15,18-Heneicosapentaenoic acid ethyl ester
HY-124118-01 5 mg

(all-Z) -6,9,12,15,18-Heneicosapentaenoic acid ethyl ester

Sign In for Pricing
View Details
(all-Z) -6,9,12,15,18-Heneicosapentaenoic acid ethyl ester
HY-124118-02 10 mg

(all-Z) -6,9,12,15,18-Heneicosapentaenoic acid ethyl ester

Sign In for Pricing
View Details
(all-Z) -6,9,12,15,18-Heneicosapentaenoic acid ethyl ester
HY-124118-03 25 mg

(all-Z) -6,9,12,15,18-Heneicosapentaenoic acid ethyl ester

Sign In for Pricing
View Details
(all-Z) -6,9,12,15,18-Heneicosapentaenoic acid ethyl ester
HY-124118-04 50 mg

(all-Z) -6,9,12,15,18-Heneicosapentaenoic acid ethyl ester

Sign In for Pricing
View Details