Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Membrane protein insertase YidC 2 (yidC2)

This Recombinant Membrane protein insertase YidC 2 (yidC2) spans the amino acid sequence from region 24-310.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC 2, Foldase YidC 2, Membrane integrase YidC 2, Membrane protein YidC 2

UniProt

Q8DSP8

Expression Region

24-310

Origin

Streptococcus mutans

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CVQMKNGKPTGEGWVYKFFAAPMGSVIQYLANNLGLGFGFAIIIVTVIVRLLILPLGLSQ VRKMTYQSEKMAYLKPVFDPIQERMKNAKTQEEKMAAQTELMQAQRHYGMSMFGGLGCLP LLIQMPFFSALYISTRYTKGIASASFLGIKLGSPNMIITVIIGILYLVQSWVSTLSVPEA QRQQTRNMMFMMPIMMVMISIGAPAGGALYWLVSGIFGLIQQLITNHIIKPKLRKQIDEE FKKNPPKPFKSNARKDITPQANNDKKLITSKKQKSNRNAGKQRHHKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Ly9 shRNA (UAS) - Lentiviral mouse Ly9 shRNA (UAS, RFP) plasmid
GTR15267253 1 Vial

Lentiviral mouse Ly9 shRNA (UAS) - Lentiviral mouse Ly9 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
PMEL Recombinant Protein
OPCA02791-20UG 20 µg

PMEL Recombinant Protein

Sign In for Pricing
View Details
PEN2 Rabbit mAb
AB103079 100 µL

PEN2 Rabbit mAb

Sign In for Pricing
View Details
Anti-B7-H1/PD-L1/CD274 Reference Antibody (cosibelimab)
MBS9247427-01 0.1 mg

Anti-B7-H1/PD-L1/CD274 Reference Antibody (cosibelimab)

Sign In for Pricing
View Details
Anti-B7-H1/PD-L1/CD274 Reference Antibody (cosibelimab)
MBS9247427-02 5x 0.1 mg

Anti-B7-H1/PD-L1/CD274 Reference Antibody (cosibelimab)

Sign In for Pricing
View Details
ARHGEF18, NT (ARHGEF18, KIAA0521, Rho guanine nucleotide exchange factor 18, 114kD Rho-specific guanine nucleotide exchange factor, Septin-associated RhoGEF) (MaxLight 490) discontinued
032049-ML490 100 µL

ARHGEF18, NT (ARHGEF18, KIAA0521, Rho guanine nucleotide exchange factor 18, 114kD Rho-specific guanine nucleotide exchange factor, Septin-associated RhoGEF) (MaxLight 490) discontinued

Sign In for Pricing
View Details