Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protease HtpX homolog (htpX)

This Recombinant Protease HtpX homolog (htpX) spans the amino acid sequence from region 1-287.

Product Specifications

Product Name Alternative

Protease HtpX homolog, EC= 3.4.24.-

UniProt

Q9CBA4

Expression Region

1-287

Origin

Mycobacterium leprae

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTWHPQANRLKTFVLLVGMSTLIVVVGAIFGRTALFFATLVAVGINVYTYYNSDKLALRA MHAQPVSEVQAPVMYRIVRELATGAHQPMPRLYISDTNAPNAFATGRNPRNAAVCCTTGI LEILNERELRAVLGHELSHVYNRDILISCVAGALAGVITALANMAMWAGTFGTTRDEENP FALLLVSLLGPIAATVVRLAVSRSREYQADESGAMLTGDPLALASALRKISSGVQAAPLP PEPQLASQAHLMIANPFRVGDRIGSLFSTHPPIEDRIRRLETMVAGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KK LC 1 (CT83) (NM_001017978) Human Over-expression Lysate
LY400409 100 µg

KK LC 1 (CT83) (NM_001017978) Human Over-expression Lysate

Sign In for Pricing
View Details
ANGPTL2 Rabbit Polyclonal Antibody
TA372957 100 µL

ANGPTL2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human C4orf40 (PRR27) activation kit by CRISPRa
GA118310 1 Kit

Human C4orf40 (PRR27) activation kit by CRISPRa

Sign In for Pricing
View Details
SPINK1 Polyclonal Antibody
E-AB-90260-01 60 µL

SPINK1 Polyclonal Antibody

Sign In for Pricing
View Details
SPINK1 Polyclonal Antibody
E-AB-90260-02 120 µL

SPINK1 Polyclonal Antibody

Sign In for Pricing
View Details
SPINK1 Polyclonal Antibody
E-AB-90260-03 200 µL

SPINK1 Polyclonal Antibody

Sign In for Pricing
View Details