Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Ferredoxin-type protein napH (napH)

This Recombinant Escherichia coli Ferredoxin-type protein napH (napH) spans the amino acid sequence from region 1-287.

Product Specifications

Product Name Alternative

Ferredoxin-type protein napH

UniProt

P33934

Expression Region

1-287

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MANRKRDAGREALEKKGWWRSHRWLVLRRLCQFFVLGMFLSGPWFGVWILHGNYSSSLLF DTVPLTDPLMTLQSLASGHLPATVALTGAVIITVLYALAGKRLFCSWVCPLNPITDLANW LRRRFDLNQSATIPRHIRYVLLVVILVGSALTGTLIWEWINPVSLMGRSLVMGFGSGALL ILALFLFDLLVVEHGWCGHICPVGALYGVLGSKGVITVAATDRQKCNRCMDCFHVCPEPH VLRAPVLDEQSPVQVTSRDCMTCGRCVDVCSEDVFTITTRWSSGAKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse anti-bovine pregnancy associated glycoproteins mAb (C1)
A09V06-C1 1 Each

Mouse anti-bovine pregnancy associated glycoproteins mAb (C1)

Sign In for Pricing
View Details
Anti-beta2-Microglobulin Monoclonal Antibody (Clone:B2M-02)
30-1316-0.1 0.1 mg

Anti-beta2-Microglobulin Monoclonal Antibody (Clone:B2M-02)

Sign In for Pricing
View Details
Recombinant Campylobacter fetus subsp. fetus Phospho-N-acetylmuramoyl-pentapeptide-transferase (mraY), partial
MBS1193741-01 1 mg (E-Coli)

Recombinant Campylobacter fetus subsp. fetus Phospho-N-acetylmuramoyl-pentapeptide-transferase (mraY), partial

Sign In for Pricing
View Details
Recombinant Campylobacter fetus subsp. fetus Phospho-N-acetylmuramoyl-pentapeptide-transferase (mraY), partial
MBS1193741-02 1 mg (Yeast)

Recombinant Campylobacter fetus subsp. fetus Phospho-N-acetylmuramoyl-pentapeptide-transferase (mraY), partial

Sign In for Pricing
View Details
SIX1 Antibody - middle region : HRP (ARP38718_P050-HRP)
ARP38718_P050-HRP 100 µL

SIX1 Antibody - middle region : HRP (ARP38718_P050-HRP)

Sign In for Pricing
View Details
HSP90AB1 antibody
FNab04053 100 µg

HSP90AB1 antibody

Sign In for Pricing
View Details