Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Ferredoxin-type protein napH (napH)

This Recombinant Escherichia coli Ferredoxin-type protein napH (napH) spans the amino acid sequence from region 1-287.

Product Specifications

Product Name Alternative

Ferredoxin-type protein napH

UniProt

P33934

Expression Region

1-287

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MANRKRDAGREALEKKGWWRSHRWLVLRRLCQFFVLGMFLSGPWFGVWILHGNYSSSLLF DTVPLTDPLMTLQSLASGHLPATVALTGAVIITVLYALAGKRLFCSWVCPLNPITDLANW LRRRFDLNQSATIPRHIRYVLLVVILVGSALTGTLIWEWINPVSLMGRSLVMGFGSGALL ILALFLFDLLVVEHGWCGHICPVGALYGVLGSKGVITVAATDRQKCNRCMDCFHVCPEPH VLRAPVLDEQSPVQVTSRDCMTCGRCVDVCSEDVFTITTRWSSGAKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Campylobacter Jejuni truD Protein (aa 1-372) (strain 81-176)
VAng-Ly2477-500gEcoli 500 µg (E. coli)

Recombinant Campylobacter Jejuni truD Protein (aa 1-372) (strain 81-176)

Sign In for Pricing
View Details
5- (3-Methoxy-2-methylphenyl) thiazol-2-amine
OR1089538-01 250 mg

5- (3-Methoxy-2-methylphenyl) thiazol-2-amine

Sign In for Pricing
View Details
5- (3-Methoxy-2-methylphenyl) thiazol-2-amine
OR1089538-02 500 mg

5- (3-Methoxy-2-methylphenyl) thiazol-2-amine

Sign In for Pricing
View Details
5- (3-Methoxy-2-methylphenyl) thiazol-2-amine
OR1089538-03 1 g

5- (3-Methoxy-2-methylphenyl) thiazol-2-amine

Sign In for Pricing
View Details
Amphiphysin Rabbit pAb, Pacific Blue conjugated
orb2855493 100 µL

Amphiphysin Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details
SPAC1805.10 Antibody
orb857055 2 mg

SPAC1805.10 Antibody

Sign In for Pricing
View Details