Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Ferredoxin-type protein napH (napH)

This Recombinant Escherichia coli Ferredoxin-type protein napH (napH) spans the amino acid sequence from region 1-287.

Product Specifications

Product Name Alternative

Ferredoxin-type protein napH

UniProt

P33934

Expression Region

1-287

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MANRKRDAGREALEKKGWWRSHRWLVLRRLCQFFVLGMFLSGPWFGVWILHGNYSSSLLF DTVPLTDPLMTLQSLASGHLPATVALTGAVIITVLYALAGKRLFCSWVCPLNPITDLANW LRRRFDLNQSATIPRHIRYVLLVVILVGSALTGTLIWEWINPVSLMGRSLVMGFGSGALL ILALFLFDLLVVEHGWCGHICPVGALYGVLGSKGVITVAATDRQKCNRCMDCFHVCPEPH VLRAPVLDEQSPVQVTSRDCMTCGRCVDVCSEDVFTITTRWSSGAKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADA2a (TADA2A) Rabbit Polyclonal Antibody
TA335196 100 µL

ADA2a (TADA2A) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SLK Human shRNA Lentiviral Particle (Locus ID 9748)
TL320620V 500 µL Each

SLK Human shRNA Lentiviral Particle (Locus ID 9748)

Sign In for Pricing
View Details
1-Chloro-1,1-difluoroacetylacetone
PC1753G 1 Each

1-Chloro-1,1-difluoroacetylacetone

Sign In for Pricing
View Details
TGFBI Recombinant Antibody, Cy7 Conjugated
bsm-54085R-Cy7-TR 20 µL

TGFBI Recombinant Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
Dnm1l Mouse shRNA Plasmid (Locus ID 74006)
TL516919 1 Kit

Dnm1l Mouse shRNA Plasmid (Locus ID 74006)

Sign In for Pricing
View Details
HAND2 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-22974R-BF350 100 µL

HAND2 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details