Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog Protein CLN8 (CLN8)

This Recombinant Dog Protein CLN8 (CLN8) spans the amino acid sequence from region 1-288.

Product Specifications

Product Name Alternative

Protein CLN8

UniProt

Q5JZQ7

Expression Region

1-288

Origin

Canis familiaris (Dog) (Canis lupus familiaris)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTPMSDGGTSESIFDLDYTSWKIRSTLAVAGFVFYLGVFVVCHQLSSSLNATYRSLVARE KVFWNLAATRAVFGVQSTAAGLWALLVDPVLHADKARGQQNWCWFHIATATGFFFFENVA VHLSNVLFRTFDLFLAIHHLFAFLGFLGSVVNLGAGHYLAMSTLLLEASTPFTCISWMLL KAGWSESLFWKLNQWLMIHMFHCRMVLTYHMWWVCFWHWDGLVSSLYLPHLALFLVGLGL LTLVINPYWTHKKTQQLLNPVDWNFAQPAPRSSRPAGANGQVPQKKGQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC Anti-Mouse IFN-γ Antibody[XMG1.2]
E-AB-F1101UE-01 25 µg

APC Anti-Mouse IFN-γ Antibody[XMG1.2]

Sign In for Pricing
View Details
APC Anti-Mouse IFN-γ Antibody[XMG1.2]
E-AB-F1101UE-02 100 µg

APC Anti-Mouse IFN-γ Antibody[XMG1.2]

Sign In for Pricing
View Details
RNASE12 Human Gene Knockout Kit (CRISPR)
KN422112 1 Kit

RNASE12 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SCLY Antibody
KC-46397-01 50 μL

SCLY Antibody

Sign In for Pricing
View Details
SCLY Antibody
KC-46397-02 100 µL

SCLY Antibody

Sign In for Pricing
View Details
SCLY Antibody
KC-46397-03 1 mL

SCLY Antibody

Sign In for Pricing
View Details