Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Presqualene diphosphate phosphatase (ppapdc2)

This Recombinant Danio rerio Presqualene diphosphate phosphatase (ppapdc2) spans the amino acid sequence from region 1-288.

Product Specifications

Product Name Alternative

Presqualene diphosphate phosphatase, EC= 3.1.3.-, Phosphatidic acid phosphatase type 2 domain-containing protein 2

UniProt

Q5TZ07

Expression Region

1-288

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPSPKARSGSGRSGSVPCPGGNGRYEFISLNRTPPSPVPPQLLQRQGSDPTTARLRASES PVRRRGSGSSNSSTGGGGQQLPEEDCMRLNPSFFGIALSSLLAIDLWLSKRLGVCACEDS SWGSVRPLMKLIEVSGHGIPWLAGAAYCLYKSDSPAGQEVMLNLLMALVLDVVLVGVLKA VVRRRRPAHNRMDMFATFSVDSYSFPSGHATRAAMCARFLLNHLVLAAPLRVLVLLWATI VGFSRVLLGRHNVTDVAFGFFMGYWQYNLVEMLWLSPVMLQSAIGQLH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DPH2 Human Gene Knockout Kit (CRISPR)
KN201382RB 1 Kit

DPH2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant SOX9 Antibody
RC-16764-01 50 μL

Recombinant SOX9 Antibody

Sign In for Pricing
View Details
Recombinant SOX9 Antibody
RC-16764-02 100 µL

Recombinant SOX9 Antibody

Sign In for Pricing
View Details
Recombinant SOX9 Antibody
RC-16764-03 1 mL

Recombinant SOX9 Antibody

Sign In for Pricing
View Details
PRR5 Antibody (Biotin)
KB-8198-01 50 μL

PRR5 Antibody (Biotin)

Sign In for Pricing
View Details
PRR5 Antibody (Biotin)
KB-8198-02 100 µL

PRR5 Antibody (Biotin)

Sign In for Pricing
View Details