Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Protein CLN8 (Cln8)

This Recombinant Rat Protein CLN8 (Cln8) spans the amino acid sequence from region 1-288.

Product Specifications

Product Name Alternative

Protein CLN8

UniProt

Q6AYM9

Expression Region

1-288

Origin

Rattus norvegicus (Rat)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTPVSNHGVAESIFDLDYASWKIRSTLAVAGFVFYLGVFVVCHQLSSSLNATYRSLLAKE KVFWNLAATRAVFGIQSTAAGLWALLGDPVLYSNKALGQQNWCWFHITTATGFFFFENAA VHLSNLFFRTFDLFLVVHHLFAFLGFLGSAVNLRAGHYLAMTTLLLEMSTPFTCVSWMLL KAGWSHSLFWKVNQWLMIHMFHCRMILTYHMWWVCFQHWDALASSLYLPHLALFLFGLAL LTVIINPYWTHKKTQQLLNPVDWNFAQPEAKGDRQERTNGQVPRKKRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MXRA8 Human Gene Knockout Kit (CRISPR)
KN400955 1 Kit

MXRA8 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cytochrome C (Mitochondrial Marker) (rCYCS/1010), 1mg/mL
BNUM3641-50 1x 50 µL

Cytochrome C (Mitochondrial Marker) (rCYCS/1010), 1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS713743 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
Recombinant E-Cadherin/CDH1/E-cad/CD324 Monoclonal Antibody
AN300023P 100 µL

Recombinant E-Cadherin/CDH1/E-cad/CD324 Monoclonal Antibody

Sign In for Pricing
View Details
Erlenmeyer Flasks
F4068 10 Plates/Pack

Erlenmeyer Flasks

Sign In for Pricing
View Details
Frozen Tissue Sections, Thyroid gland
CS505520 5x 5 µm

Frozen Tissue Sections, Thyroid gland

Sign In for Pricing
View Details