Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Protein CLN8 (Cln8)

This Recombinant Rat Protein CLN8 (Cln8) spans the amino acid sequence from region 1-288.

Product Specifications

Product Name Alternative

Protein CLN8

UniProt

Q6AYM9

Expression Region

1-288

Origin

Rattus norvegicus (Rat)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTPVSNHGVAESIFDLDYASWKIRSTLAVAGFVFYLGVFVVCHQLSSSLNATYRSLLAKE KVFWNLAATRAVFGIQSTAAGLWALLGDPVLYSNKALGQQNWCWFHITTATGFFFFENAA VHLSNLFFRTFDLFLVVHHLFAFLGFLGSAVNLRAGHYLAMTTLLLEMSTPFTCVSWMLL KAGWSHSLFWKVNQWLMIHMFHCRMILTYHMWWVCFQHWDALASSLYLPHLALFLFGLAL LTVIINPYWTHKKTQQLLNPVDWNFAQPEAKGDRQERTNGQVPRKKRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Transmembrane Protein 27 (TMEM27) ELISA Kit
RDR-TMEM27-Hu-01 96 Tests

Human Transmembrane Protein 27 (TMEM27) ELISA Kit

Sign In for Pricing
View Details
Human Transmembrane Protein 27 (TMEM27) ELISA Kit
RDR-TMEM27-Hu-02 48 Tests

Human Transmembrane Protein 27 (TMEM27) ELISA Kit

Sign In for Pricing
View Details
1X Tris-EDTA (TE) Buffer, pH8.0, Ultra Pure Grade, 500ml
PB1215-500ml 500 mL

1X Tris-EDTA (TE) Buffer, pH8.0, Ultra Pure Grade, 500ml

Sign In for Pricing
View Details
Mouse IL-27A p28 Recombinant Rabbit monoclonal Antibody
HA723627 100 µL

Mouse IL-27A p28 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
CD268 / BAFFR / TNFRSF13C (BAFFR/1557), CF740 conjugate, 0.1mg/mL
BNC741557-100 1x 100 µL

CD268 / BAFFR / TNFRSF13C (BAFFR/1557), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (EGP40/837), Biotin conjugate, 0.1mg/mL
BNCB0837-500 1x 500 µL

Ep-CAM / CD326 (EGP40/837), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details