Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arthrobacter sp. Protease HtpX homolog (htpX)

This Recombinant Arthrobacter sp. Protease HtpX homolog (htpX) spans the amino acid sequence from region 1-289.

Product Specifications

Product Name Alternative

Protease HtpX homolog, EC= 3.4.24.-

UniProt

A0JZI3

Expression Region

1-289

Origin

Arthrobacter sp. (strain FB24)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHNHHNGLKTAALFGVLWAVLLGLGAVIGSSMRSTTPIWIMALVGVGTTAYGYWNSDKLA LRSMQAYPVTEEQAPQLYQIVRELSAKANQPMPRIYVSPTPAPNAFATGRNPQNAAVCCT EGILRLLSLRELRGVLGHELMHVYNRDILTSSVAAAVAGVITSVGQMLLIFGGGDRRNSN PLAVMAMALLAPLAAVVIQSAISRTREYDADEDGSALTGDPLALASALRKIHQGVQMVPL PPDQKLVNTSHLMIANPFRAGGVTRMFATHPPMQDRITRLELMAGGPAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GTPBP10 (NM_001042717) Human Untagged Clone
SC311467 10 µg

GTPBP10 (NM_001042717) Human Untagged Clone

Sign In for Pricing
View Details
NARS2 Mouse Monoclonal Antibody [Clone ID: LBI8D10]
AMM17363VCF 100 µg

NARS2 Mouse Monoclonal Antibody [Clone ID: LBI8D10]

Sign In for Pricing
View Details
RAB21 Mouse Monoclonal Antibody [Clone:6B1]
E45M13444 100 µg

RAB21 Mouse Monoclonal Antibody [Clone:6B1]

Sign In for Pricing
View Details
Rat Beta-defensin 4 ELISA Kit
MBS2886264-01 48 Well

Rat Beta-defensin 4 ELISA Kit

Sign In for Pricing
View Details
Rat Beta-defensin 4 ELISA Kit
MBS2886264-02 96 Well

Rat Beta-defensin 4 ELISA Kit

Sign In for Pricing
View Details
Rat Beta-defensin 4 ELISA Kit
MBS2886264-03 5x 96 Well

Rat Beta-defensin 4 ELISA Kit

Sign In for Pricing
View Details