Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arthrobacter sp. Protease HtpX homolog (htpX)

This Recombinant Arthrobacter sp. Protease HtpX homolog (htpX) spans the amino acid sequence from region 1-289.

Product Specifications

Product Name Alternative

Protease HtpX homolog, EC= 3.4.24.-

UniProt

A0JZI3

Expression Region

1-289

Origin

Arthrobacter sp. (strain FB24)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHNHHNGLKTAALFGVLWAVLLGLGAVIGSSMRSTTPIWIMALVGVGTTAYGYWNSDKLA LRSMQAYPVTEEQAPQLYQIVRELSAKANQPMPRIYVSPTPAPNAFATGRNPQNAAVCCT EGILRLLSLRELRGVLGHELMHVYNRDILTSSVAAAVAGVITSVGQMLLIFGGGDRRNSN PLAVMAMALLAPLAAVVIQSAISRTREYDADEDGSALTGDPLALASALRKIHQGVQMVPL PPDQKLVNTSHLMIANPFRAGGVTRMFATHPPMQDRITRLELMAGGPAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIM37 (NM_015294) Human Untagged Clone
SC102603 10 µg

TRIM37 (NM_015294) Human Untagged Clone

Sign In for Pricing
View Details
Quick Step Bovine Vasoactive Intestinal Peptide (VIP) elisa Kit
QS0193Bo-01 48 Tests

Quick Step Bovine Vasoactive Intestinal Peptide (VIP) elisa Kit

Sign In for Pricing
View Details
Quick Step Bovine Vasoactive Intestinal Peptide (VIP) elisa Kit
QS0193Bo-02 96 Tests

Quick Step Bovine Vasoactive Intestinal Peptide (VIP) elisa Kit

Sign In for Pricing
View Details
CKB Antibody - middle region
OAAB17706-400UL 400 µL

CKB Antibody - middle region

Sign In for Pricing
View Details
Anti- Protein J5(N-terminal) Polyclonal Antibody
AB3J071 0.1mg

Anti- Protein J5(N-terminal) Polyclonal Antibody

Sign In for Pricing
View Details
MEF2A sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1288006 1.0 µg DNA

MEF2A sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details