Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vibrio harveyi Protease HtpX (htpX)

This Recombinant Vibrio harveyi Protease HtpX (htpX) spans the amino acid sequence from region 1-289.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

A7MX22

Expression Region

1-289

Origin

Vibrio harveyi (strain ATCC BAA-1116 / BB120)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKRIMLFLATNLAVVLVLSVVLNIVYAVTGMQPGSLSGLLVMAAVFGFGGAFISLMMSKG MALRSVGGMVIESPRNETEHWLLETVGRQAQQAGIGMPTVAIYEAADINAFATGAKRDDS LVAVSTGLLHNMTRDEAEAVLAHEVSHIANGDMVTMTLMQGVVNTFVIFLSRFIANIVAS NDDEEGQGTNMMVYFGVSMVLELVFGFLASFLTMWYSRHREFHADAGAAQLVGKEKMIAA LERLKMSHESQLDGTMMAFGINGKRSMTELLMSHPPLDKRISALRSQQY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRPF31 Recombinant Rabbit Monoclonal Antibody [JE64-82]
HA721089 100 µL

PRPF31 Recombinant Rabbit Monoclonal Antibody [JE64-82]

Sign In for Pricing
View Details
C20orf27 (NM_001039140) Human Over-expression Lysate
LC422021 20 µg

C20orf27 (NM_001039140) Human Over-expression Lysate

Sign In for Pricing
View Details
Prohibitin (Mitochondrial Marker) (PHB/3194), CF568 conjugate, 0.1mg/mL
BNC683194-500 1x 500 µL

Prohibitin (Mitochondrial Marker) (PHB/3194), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SHIP (INPP5D) (Center) Rabbit Polyclonal Antibody
AP12504PU-N 400 µL

SHIP (INPP5D) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mesothelin (Mesothelial Marker) (MSLN/2131), CF647 conjugate, 0.1mg/mL
BNC472131-500 1x 500 µL

Mesothelin (Mesothelial Marker) (MSLN/2131), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ier3 (NM_133662) Mouse Tagged ORF Clone
MG201231 10 µg

Ier3 (NM_133662) Mouse Tagged ORF Clone

Sign In for Pricing
View Details