Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vibrio harveyi Protease HtpX (htpX)

This Recombinant Vibrio harveyi Protease HtpX (htpX) spans the amino acid sequence from region 1-289.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

A7MX22

Expression Region

1-289

Origin

Vibrio harveyi (strain ATCC BAA-1116 / BB120)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKRIMLFLATNLAVVLVLSVVLNIVYAVTGMQPGSLSGLLVMAAVFGFGGAFISLMMSKG MALRSVGGMVIESPRNETEHWLLETVGRQAQQAGIGMPTVAIYEAADINAFATGAKRDDS LVAVSTGLLHNMTRDEAEAVLAHEVSHIANGDMVTMTLMQGVVNTFVIFLSRFIANIVAS NDDEEGQGTNMMVYFGVSMVLELVFGFLASFLTMWYSRHREFHADAGAAQLVGKEKMIAA LERLKMSHESQLDGTMMAFGINGKRSMTELLMSHPPLDKRISALRSQQY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CAMK1D (NM_153498) Human Recombinant Protein
TP307736M 100 µg

CAMK1D (NM_153498) Human Recombinant Protein

Sign In for Pricing
View Details
Mrpl16 Rabbit Polyclonal Antibody
TA363335 100 µL

Mrpl16 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HSV1 (Herpes Simplex Virus Type I) (10A3), CF594 conjugate, 0.1mg/mL
BNC941793-100 1x 100 µL

HSV1 (Herpes Simplex Virus Type I) (10A3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (CG106), CF740 conjugate, 0.1mg/mL
BNC742216-500 1x 500 µL

CD50 / ICAM3 (CG106), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CHRNA6 Human Gene Knockout Kit (CRISPR)
KN204868BN 1 Kit

CHRNA6 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human OR6K3 activation kit by CRISPRa
GA118199 1 Kit

Human OR6K3 activation kit by CRISPRa

Sign In for Pricing
View Details