Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vibrio harveyi Protease HtpX (htpX)

This Recombinant Vibrio harveyi Protease HtpX (htpX) spans the amino acid sequence from region 1-289.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

A7MX22

Expression Region

1-289

Origin

Vibrio harveyi (strain ATCC BAA-1116 / BB120)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKRIMLFLATNLAVVLVLSVVLNIVYAVTGMQPGSLSGLLVMAAVFGFGGAFISLMMSKG MALRSVGGMVIESPRNETEHWLLETVGRQAQQAGIGMPTVAIYEAADINAFATGAKRDDS LVAVSTGLLHNMTRDEAEAVLAHEVSHIANGDMVTMTLMQGVVNTFVIFLSRFIANIVAS NDDEEGQGTNMMVYFGVSMVLELVFGFLASFLTMWYSRHREFHADAGAAQLVGKEKMIAA LERLKMSHESQLDGTMMAFGINGKRSMTELLMSHPPLDKRISALRSQQY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fam107b (NM_025626) Mouse Tagged ORF Clone
MG200749 10 µg

Fam107b (NM_025626) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
CF®488A-Dextran 40,000 MW, Anionic and Fixable
#80126 1x 1 mg

CF®488A-Dextran 40,000 MW, Anionic and Fixable

Sign In for Pricing
View Details
Hgd Mouse Gene Knockout Kit (CRISPR)
KN307689BN 1 Kit

Hgd Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MAD2L1 binding protein (MAD2L1BP) (N-term) Rabbit Polyclonal Antibody
AP52580PU-N 400 µL

MAD2L1 binding protein (MAD2L1BP) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
14-3-3 alpha+beta Mouse Monoclonal Antibody [9-26]
M0407-14 100 µL

14-3-3 alpha+beta Mouse Monoclonal Antibody [9-26]

Sign In for Pricing
View Details
Mouse Tumor Necrosis Factor Ligand Superfamily, Member 13 (TNFSF13) ELISA Kit
RDR-TNFSF13-Mu-01 96 Tests

Mouse Tumor Necrosis Factor Ligand Superfamily, Member 13 (TNFSF13) ELISA Kit

Sign In for Pricing
View Details