Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xylella fastidiosa Protease HtpX (htpX)

This Recombinant Xylella fastidiosa Protease HtpX (htpX) spans the amino acid sequence from region 1-289.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

B2IA62

Expression Region

1-289

Origin

Xylella fastidiosa (strain M23)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLTRIVLFAITNIAVLILASIVMSLLGVNPTQMSGLLVMALILGFGGSLISLLMSKAIAK HTTGAYVIEQPRNPSQRWLLDTVRRQAEIVGIGMPEVAIYEGPEINAFATGADRNNALVA VSTGLLQNMSQDEAEAVLGHEIAHVANGDMVTMALLQGVLNTFVIVLARVVGGFIDSLLS GNRGGGRGVAYYGIVLVLELLFGLFATIITMWFSRRREFRADEGGAYLAGRNKMIAALER LGINHGQSTLPTQVQAFGIYGGIGEGLRKLFLSHPPLSERIAALRMARE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MSMB (NM_002443) Human Over-expression Lysate
LC400872 20 µg

MSMB (NM_002443) Human Over-expression Lysate

Sign In for Pricing
View Details
Human ZNF146 activation kit by CRISPRa
GA105264 1 Kit

Human ZNF146 activation kit by CRISPRa

Sign In for Pricing
View Details
Lauroyl Chloride
TRC-L178630-50ML 50 mL

Lauroyl Chloride

Sign In for Pricing
View Details
EDG6 Polyclonal Antibody
E-AB-12922-01 20 µL

EDG6 Polyclonal Antibody

Sign In for Pricing
View Details
EDG6 Polyclonal Antibody
E-AB-12922-02 60 µL

EDG6 Polyclonal Antibody

Sign In for Pricing
View Details
EDG6 Polyclonal Antibody
E-AB-12922-03 120 µL

EDG6 Polyclonal Antibody

Sign In for Pricing
View Details