Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nostoc punctiforme Protease HtpX homolog (htpX)

This Recombinant Nostoc punctiforme Protease HtpX homolog (htpX) spans the amino acid sequence from region 1-289.

Product Specifications

Product Name Alternative

Protease HtpX homolog, EC= 3.4.24.-

UniProt

B2J204

Expression Region

1-289

Origin

Nostoc punctiforme (strain ATCC 29133 / PCC 73102)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGNQVKTAALLAALSGLLIAISYWVIGGSSGLIIGIGLAAVTNLFSWYQSDKIALAVYQA QPVSEGEAPGLYRMVQRLSDRANIPMPRVYIVPSQGANAFATGRDPEHAAVAVTEGILNI LPDDELEGVIAHELTHIINRDTLTQAVAATVAGAISFLAQMVSYSLWFGGGSRDDNRGAN PLGVLLTVMLAPLAATIIQLAISRTREFSADAGSARLTGNPRALARALQRLEALAKQIPL NANPAFEPLLIINSISGQFLGNLFSSHPATEARVAALLKLEQQLPTKAY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD10 (CB-CALLA), CF640R conjugate, 0.1mg/mL
BNC400146-500 1x 500 µL

CD10 (CB-CALLA), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF594 conjugate, 0.1mg/mL
BNC940352-100 1x 100 µL

CD31 / PECAM-1 (158-2B3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
S100A4 (Marker of Tumor Metastasis) (S100A4/1482), CF594 conjugate, 0.1mg/mL
BNC941482-100 1x 100 µL

S100A4 (Marker of Tumor Metastasis) (S100A4/1482), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (45M1), CF740 conjugate, 0.1mg/mL
BNC740031-500 1x 500 µL

Mucin 5AC (MUC5AC) (45M1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (C5/473), CF594 conjugate, 0.1mg/mL
BNC940473-500 1x 500 µL

CD5 (C5/473), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgM Immunoglobulin (IM373), CF405S conjugate, 0.1mg/mL
BNC040373-100 1x 100 µL

Human IgM Immunoglobulin (IM373), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details