Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arthrobacter chlorophenolicus Protease HtpX homolog (htpX)

This Recombinant Arthrobacter chlorophenolicus Protease HtpX homolog (htpX) spans the amino acid sequence from region 1-289.

Product Specifications

Product Name Alternative

Protease HtpX homolog, EC= 3.4.24.-

UniProt

B8HDM6

Expression Region

1-289

Origin

Arthrobacter chlorophenolicus (strain A6 / ATCC 700700 / DSM 12829 / JCM 12360)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHKHHNGLKTAALFGVLWAVLLALGALIGAGTRSSAPIWIMALVGVGTTFYGYWNSDKIA IRSMQAFEVSEAQAPQLYQIVRELSARANQPMPRIYVSPTMNPNAFATGRNPQNAAVCCT EGILQLLDARELRGVLGHELMHVYNRDILTSSVAAAVAGVITSVGQMLLFFGGGDRRNAN PLAMIAMALLAPFAASLIQMAISRTREYDADEDGSQLTGDPLALASALAKIERGVTMVPL PPDQRLVNASHLMIANPFRGGAMNKLFATHPPMRDRIARLERMAGRPLQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human CREBL2 shRNA (UAS) - Lentiviral human CREBL2 shRNA (UAS) (25)
GTR15099269 1 Vial

Lentiviral human CREBL2 shRNA (UAS) - Lentiviral human CREBL2 shRNA (UAS) (25)

Sign In for Pricing
View Details
Vmn1r44 (NM_053227) Mouse Tagged ORF Clone
MR222483 10 µg

Vmn1r44 (NM_053227) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
CENPS-CORT (NM_199006) Human Over-expression Lysate
LS100526739-20ug 20 µg

CENPS-CORT (NM_199006) Human Over-expression Lysate

Sign In for Pricing
View Details
EBF4 (BC054347) Human Untagged Clone
SC126186 10 µg

EBF4 (BC054347) Human Untagged Clone

Sign In for Pricing
View Details
Anti-CCDC114 Antibody, Rabbit Polyclonal
MBS8110112-01 0.1 mL

Anti-CCDC114 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-CCDC114 Antibody, Rabbit Polyclonal
MBS8110112-02 5x 0.1 mL

Anti-CCDC114 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details