Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arthrobacter chlorophenolicus Protease HtpX homolog (htpX)

This Recombinant Arthrobacter chlorophenolicus Protease HtpX homolog (htpX) spans the amino acid sequence from region 1-289.

Product Specifications

Product Name Alternative

Protease HtpX homolog, EC= 3.4.24.-

UniProt

B8HDM6

Expression Region

1-289

Origin

Arthrobacter chlorophenolicus (strain A6 / ATCC 700700 / DSM 12829 / JCM 12360)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHKHHNGLKTAALFGVLWAVLLALGALIGAGTRSSAPIWIMALVGVGTTFYGYWNSDKIA IRSMQAFEVSEAQAPQLYQIVRELSARANQPMPRIYVSPTMNPNAFATGRNPQNAAVCCT EGILQLLDARELRGVLGHELMHVYNRDILTSSVAAAVAGVITSVGQMLLFFGGGDRRNAN PLAMIAMALLAPFAASLIQMAISRTREYDADEDGSQLTGDPLALASALAKIERGVTMVPL PPDQRLVNASHLMIANPFRGGAMNKLFATHPPMRDRIARLERMAGRPLQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Cyclohexen-1-one
TRC-C984495-50G 50 g

2-Cyclohexen-1-one

Sign In for Pricing
View Details
Tissue Total RNA, Ovary: right
CR562591 5 µg

Tissue Total RNA, Ovary: right

Sign In for Pricing
View Details
Recombinant Rb (phospho T356) Antibody
RC-6411-01 50 μL

Recombinant Rb (phospho T356) Antibody

Sign In for Pricing
View Details
Recombinant Rb (phospho T356) Antibody
RC-6411-02 100 µL

Recombinant Rb (phospho T356) Antibody

Sign In for Pricing
View Details
Recombinant Rb (phospho T356) Antibody
RC-6411-03 1 mL

Recombinant Rb (phospho T356) Antibody

Sign In for Pricing
View Details
ALG1L2 Human Gene Knockout Kit (CRISPR)
KN427053 1 Kit

ALG1L2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details