Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Haemophilus ducreyi Protease HtpX (htpX)

This Recombinant Haemophilus ducreyi Protease HtpX (htpX) spans the amino acid sequence from region 1-289.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

Q7VNX2

Expression Region

1-289

Origin

Haemophilus ducreyi (strain 35000HP / ATCC 700724)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKRVILFLLTNLAITFVLGIVLNIIFQVTGIKGTSTTGILMMSLLFGFTGSLISLFMSK SMALRSVGAEVIQQPRNQAEQWLFNTVQRQSQKAGIPMPDIAIYHSADVNAFATGATKNN SLVAVSTGLLDNMTEDEAEAVVAHEIAHIANGDMVTMTLLQGVLNTFVIFLSRMISTAVS GSRDENGNSTQNTLVFWVVDIALQMIFGILATMIAMWFSRYREYRADMGSAQLVGKEKMI AALERLRHVHEPQEMQGSLSAFMINGIRSKELFMSHPPLEKRIEALRNL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phenazine Biosynthesis-Like Domain-Containing Protein (PBLD) Antibody (HRP)
abx304751-01 20 µg

Phenazine Biosynthesis-Like Domain-Containing Protein (PBLD) Antibody (HRP)

Sign In for Pricing
View Details
Phenazine Biosynthesis-Like Domain-Containing Protein (PBLD) Antibody (HRP)
abx304751-02 50 µg

Phenazine Biosynthesis-Like Domain-Containing Protein (PBLD) Antibody (HRP)

Sign In for Pricing
View Details
Phenazine Biosynthesis-Like Domain-Containing Protein (PBLD) Antibody (HRP)
abx304751-03 100 µg

Phenazine Biosynthesis-Like Domain-Containing Protein (PBLD) Antibody (HRP)

Sign In for Pricing
View Details
Phenazine Biosynthesis-Like Domain-Containing Protein (PBLD) Antibody (HRP)
abx304751-04 200 µg

Phenazine Biosynthesis-Like Domain-Containing Protein (PBLD) Antibody (HRP)

Sign In for Pricing
View Details
Phenazine Biosynthesis-Like Domain-Containing Protein (PBLD) Antibody (HRP)
abx304751-05 1 mg

Phenazine Biosynthesis-Like Domain-Containing Protein (PBLD) Antibody (HRP)

Sign In for Pricing
View Details
AP1AR Protein Vector (Rat) (pPB-C-His)
PV253870 500 ng

AP1AR Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details