Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Haemophilus ducreyi Protease HtpX (htpX)

This Recombinant Haemophilus ducreyi Protease HtpX (htpX) spans the amino acid sequence from region 1-289.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

Q7VNX2

Expression Region

1-289

Origin

Haemophilus ducreyi (strain 35000HP / ATCC 700724)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKRVILFLLTNLAITFVLGIVLNIIFQVTGIKGTSTTGILMMSLLFGFTGSLISLFMSK SMALRSVGAEVIQQPRNQAEQWLFNTVQRQSQKAGIPMPDIAIYHSADVNAFATGATKNN SLVAVSTGLLDNMTEDEAEAVVAHEIAHIANGDMVTMTLLQGVLNTFVIFLSRMISTAVS GSRDENGNSTQNTLVFWVVDIALQMIFGILATMIAMWFSRYREYRADMGSAQLVGKEKMI AALERLRHVHEPQEMQGSLSAFMINGIRSKELFMSHPPLEKRIEALRNL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lrrc52 (NM_001013382) Mouse Tagged ORF Clone Lentiviral Particle
MR204479L3V 200 µL

Lrrc52 (NM_001013382) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
FIG4 Polyclonal Antibody
ABP58557-01 30 µL

FIG4 Polyclonal Antibody

Sign In for Pricing
View Details
FIG4 Polyclonal Antibody
ABP58557-02 100 µL

FIG4 Polyclonal Antibody

Sign In for Pricing
View Details
FIG4 Polyclonal Antibody
ABP58557-03 200 µL

FIG4 Polyclonal Antibody

Sign In for Pricing
View Details
plexin-B1 CRISPR/Cas9 KO Plasmid (m)
sc-433482 20 µg

plexin-B1 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
Recombinant Gorilla gorilla gorilla Polyadenylate-binding protein 5 (PABPC5)
MBS1034427-01 0.02 mg (E-Coli)

Recombinant Gorilla gorilla gorilla Polyadenylate-binding protein 5 (PABPC5)

Sign In for Pricing
View Details