Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pyrococcus furiosus Protease HtpX homolog (htpX)

This Recombinant Pyrococcus furiosus Protease HtpX homolog (htpX) spans the amino acid sequence from region 1-289.

Product Specifications

Product Name Alternative

Protease HtpX homolog, EC= 3.4.24.-

UniProt

Q8U1S0

Expression Region

1-289

Origin

Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGIGLWVRTGLLMAFLTGLLVGIGYLIGGQGGMIIAFTIALFMNFFSYWFSDSIVLSWYN ARIVSEEEAPELHRIVEKLAMQAGIPKPRVAIVPTLVPNAFATGRSPEHAVVAVTEGLLR ILNRDELEGVIAHEISHIKNRDTLIQTIAAVLAGAIMVLVNFARWSLWFGAYDEDRDGGN IVALILAIILAPIAATLIQLAISRSREYLADETGAKISGKPHALASALMKIEEAVRYRPL KNGNPATAHMFIVNPFRGVDFVELFSTHPPTEKRIERLRKIAMEMGIIF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDX2 / Caudal Type Homeobox 2 (GI Epithelial Marker) (PCRP-CDX2-1A3), CF640R conjugate, 0.1mg/mL
BNC401920-100 1x 100 µL

CDX2 / Caudal Type Homeobox 2 (GI Epithelial Marker) (PCRP-CDX2-1A3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8b, Mouse (H35-17.2), CF594 conjugate, 0.1mg/mL
BNC942003-100 1x 100 µL

CD8b, Mouse (H35-17.2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (Rabbit PAb), CF488A conjugate, 0.1mg/mL
BNC880385-500 1x 500 µL

CD3e (Rabbit PAb), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PS2 (GE2), CF740 conjugate, 0.1mg/mL
BNC740677-100 1x 100 µL

PS2 (GE2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (IAP/964 + B6H12.2), CF740 conjugate, 0.1mg/mL
BNC741029-100 1x 100 µL

CD47 (IAP/964 + B6H12.2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), 0.2mg/mL
BNUB0871-100 1x 100 µL

CD71 (66IG10), 0.2mg/mL

Sign In for Pricing
View Details