Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized transporter yeaB (yeaB)

This Recombinant Bacillus subtilis Uncharacterized transporter yeaB (yeaB) spans the amino acid sequence from region 1-290.

Product Specifications

Product Name Alternative

Uncharacterized transporter yeaB

UniProt

P46348

Expression Region

1-290

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MERYDELKKGESGALVSIAAYLVLSAIKLIIGYLFHSEALTADGLNNTTDIIASVAVLIG LRISQKPPDEDHPYGHFRAETIASLIASFIMMVVGLQVLFSAGESIFSAKQETPDMIAAW TAAGGAVLMLIVYRYNKRLAKKVKSQALLAAAADNKSDAFVSIGTFIGIVAAQFHLAWID TVTAFVIGLLICKTAWDIFKESSHSLTDGFDIKDISAYKQTIEKISGVSRLKDIKARYLG STVHVDVVVEVSADLNITESHDIANEIERRMKEEHAIDYSHVHMEPLEQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cof Antibody
orb811932 2 mg

Cof Antibody

Sign In for Pricing
View Details
ABL1/2 Blocking Peptide
CBP1005-01 1 mg

ABL1/2 Blocking Peptide

Sign In for Pricing
View Details
ABL1/2 Blocking Peptide
CBP1005-02 5 mg

ABL1/2 Blocking Peptide

Sign In for Pricing
View Details
Lentiviral human SIRT5 shRNA (UAS) - Lentiviral human SIRT5 shRNA (UAS, RFP) plasmid
GTR15318940 1 Vial

Lentiviral human SIRT5 shRNA (UAS) - Lentiviral human SIRT5 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
GPRC6A Antibody
MBS7118243-01 0.05 mg

GPRC6A Antibody

Sign In for Pricing
View Details
GPRC6A Antibody
MBS7118243-02 0.1 mg

GPRC6A Antibody

Sign In for Pricing
View Details