Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized transporter yeaB (yeaB)

This Recombinant Bacillus subtilis Uncharacterized transporter yeaB (yeaB) spans the amino acid sequence from region 1-290.

Product Specifications

Product Name Alternative

Uncharacterized transporter yeaB

UniProt

P46348

Expression Region

1-290

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MERYDELKKGESGALVSIAAYLVLSAIKLIIGYLFHSEALTADGLNNTTDIIASVAVLIG LRISQKPPDEDHPYGHFRAETIASLIASFIMMVVGLQVLFSAGESIFSAKQETPDMIAAW TAAGGAVLMLIVYRYNKRLAKKVKSQALLAAAADNKSDAFVSIGTFIGIVAAQFHLAWID TVTAFVIGLLICKTAWDIFKESSHSLTDGFDIKDISAYKQTIEKISGVSRLKDIKARYLG STVHVDVVVEVSADLNITESHDIANEIERRMKEEHAIDYSHVHMEPLEQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti Mouse HSD11B1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (Western Blot)
IRBAMSHSD11B1AP779200UL 1 Each

Rabbit Anti Mouse HSD11B1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (Western Blot)

Sign In for Pricing
View Details
Mouse IgG1 Kappa Isotype Control Monoclonal Clone MOPC21 PE/Cyanine7 25ug
IMSIGG1KICMOPC21CPECY725UG 25 µg

Mouse IgG1 Kappa Isotype Control Monoclonal Clone MOPC21 PE/Cyanine7 25ug

Sign In for Pricing
View Details
C15orf41 ORF Vector (Human) (pORF)
ORF001271 1.0 µg DNA

C15orf41 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
TAK 715
466790-01 5 mg

TAK 715

Sign In for Pricing
View Details
TAK 715
466790-02 10 mg

TAK 715

Sign In for Pricing
View Details
Vildagliptin impurity 24
orb3181271-01 50 mg

Vildagliptin impurity 24

Sign In for Pricing
View Details