Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized transporter yeaB (yeaB)

This Recombinant Bacillus subtilis Uncharacterized transporter yeaB (yeaB) spans the amino acid sequence from region 1-290.

Product Specifications

Product Name Alternative

Uncharacterized transporter yeaB

UniProt

P46348

Expression Region

1-290

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MERYDELKKGESGALVSIAAYLVLSAIKLIIGYLFHSEALTADGLNNTTDIIASVAVLIG LRISQKPPDEDHPYGHFRAETIASLIASFIMMVVGLQVLFSAGESIFSAKQETPDMIAAW TAAGGAVLMLIVYRYNKRLAKKVKSQALLAAAADNKSDAFVSIGTFIGIVAAQFHLAWID TVTAFVIGLLICKTAWDIFKESSHSLTDGFDIKDISAYKQTIEKISGVSRLKDIKARYLG STVHVDVVVEVSADLNITESHDIANEIERRMKEEHAIDYSHVHMEPLEQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FILIP1 Antibody
orb47127-01 50 µg

FILIP1 Antibody

Sign In for Pricing
View Details
FILIP1 Antibody
orb47127-02 100 µg

FILIP1 Antibody

Sign In for Pricing
View Details
Anti Human CD44 Flow Cytometry Monoclonal Clone P2A1 APC Ready To Use 200 Tests
IMSAHUCD44P2A1CAPC200 200 Tests

Anti Human CD44 Flow Cytometry Monoclonal Clone P2A1 APC Ready To Use 200 Tests

Sign In for Pricing
View Details
Mouse Chromobox Homolog 3 ELISA Kit
MBS037008-01 48 Well

Mouse Chromobox Homolog 3 ELISA Kit

Sign In for Pricing
View Details
Mouse Chromobox Homolog 3 ELISA Kit
MBS037008-02 96 Well

Mouse Chromobox Homolog 3 ELISA Kit

Sign In for Pricing
View Details
Mouse Chromobox Homolog 3 ELISA Kit
MBS037008-03 5x 96 Well

Mouse Chromobox Homolog 3 ELISA Kit

Sign In for Pricing
View Details