Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Aeromonas salmonicida Protease HtpX (htpX)

This Recombinant Aeromonas salmonicida Protease HtpX (htpX) spans the amino acid sequence from region 1-290.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

A4SPR3

Expression Region

1-290

Origin

Aeromonas salmonicida (strain A449)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKRIMLFLVTNLAVMLVLGVVLNILFSVLGINKSSISGLLMFCAVFGFGGSFISLLMSKW MAKRSYGVQVIEQPRNETEHWLVSTVARQAREAGIKMPEVGIYDSPEMNAFATGARRDDS LVAVSSGLLYSMSRDEAEAVLAHEVSHVANGDMVTLTLIQGVVNTFVMFFARIVAGVISN FFSSNNDEESSSSGGFAYMITVFVLEMAFGVLASMIVMWFSRQREFRADAGAAKLAGRDK MIAALQRLSRGAEPQMEGSMMAFGINGKRSMSELFMSHPPIEQRIAALRG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD43 (84-3C1), CF594 conjugate, 0.1mg/mL
BNC940342-500 1x 500 µL

CD43 (84-3C1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF405S conjugate, 0.1mg/mL
BNC041231-100 1x 100 µL

Eosinophil Peroxidase (AHE-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF405S conjugate, 0.1mg/mL
BNC040039-100 1x 100 µL

CD34 (ICO-115), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF740 conjugate, 0.1mg/mL
BNC740029-500 1x 500 µL

Fibronectin (TV-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AFP (Alpha Fetoprotein) (C3), CF405S conjugate, 0.1mg/mL
BNC040354-500 1x 500 µL

AFP (Alpha Fetoprotein) (C3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Kappa Light Chain / IGKC (B-Cell Marker) (KLC2289R), CF647 conjugate, 0.1mg/mL
BNC472289-100 1x 100 µL

Human Kappa Light Chain / IGKC (B-Cell Marker) (KLC2289R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details