Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas stutzeri Protease HtpX (htpX)

This Recombinant Pseudomonas stutzeri Protease HtpX (htpX) spans the amino acid sequence from region 1-290.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

A4VMI8

Expression Region

1-290

Origin

Pseudomonas stutzeri (strain A1501)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMRIFLFLATNLAVLVIASITLKLLGVDRYTGQNYGSLLVFCAVFGFAGSLISLFISKWM AKMSTRTEIISQPRTRHEQWLLQTVEQLSREAGIKMPEVGIFPAYEANAFATGWNRNDAL VAVSQGLLERFSPDEVRAVLAHEIGHVANGDMVTLALIQGVVNTFVMFFARIFGNFVDKA ILKNEDGHGIGYFVATIFAELVLGILASIIVMWFSRKREYRADEAGAQLAGTSAMIGALQ RLRAEQGLPVHMPDSLKAFGINGSLKHGMAGLFMTHPSLEDRIEALRQRG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

17Alpha-Trifluoroacetoxyfuticasone 17Beta-Carboxylic Acid
TRC-T781010-25MG 25 mg

17Alpha-Trifluoroacetoxyfuticasone 17Beta-Carboxylic Acid

Sign In for Pricing
View Details
Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/1825R), CF740 conjugate, 0.1mg/mL
BNC741825-500 1x 500 µL

Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/1825R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Kappa Light Chain (L1C1), Biotin conjugate, 0.1mg/mL
BNCB0018-100 1x 100 µL

Human Kappa Light Chain (L1C1), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
N-Nitroso Abemaciclib
TRC-N274215-250MG 250 mg

N-Nitroso Abemaciclib

Sign In for Pricing
View Details
Ruxolitinib Phosphate
TRC-R702005-250MG 250 mg

Ruxolitinib Phosphate

Sign In for Pricing
View Details
Nile Red
#60029 1x 10 mg

Nile Red

Sign In for Pricing
View Details