Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas stutzeri Protease HtpX (htpX)

This Recombinant Pseudomonas stutzeri Protease HtpX (htpX) spans the amino acid sequence from region 1-290.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

A4VMI8

Expression Region

1-290

Origin

Pseudomonas stutzeri (strain A1501)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMRIFLFLATNLAVLVIASITLKLLGVDRYTGQNYGSLLVFCAVFGFAGSLISLFISKWM AKMSTRTEIISQPRTRHEQWLLQTVEQLSREAGIKMPEVGIFPAYEANAFATGWNRNDAL VAVSQGLLERFSPDEVRAVLAHEIGHVANGDMVTLALIQGVVNTFVMFFARIFGNFVDKA ILKNEDGHGIGYFVATIFAELVLGILASIIVMWFSRKREYRADEAGAQLAGTSAMIGALQ RLRAEQGLPVHMPDSLKAFGINGSLKHGMAGLFMTHPSLEDRIEALRQRG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BLNK Mouse Monoclonal Antibody [Clone ID: 5G9]
AM06644SU-N 100 µL

BLNK Mouse Monoclonal Antibody [Clone ID: 5G9]

Sign In for Pricing
View Details
3-Ethylsalicylaldehyde
TRC-E918795-2.5G 2.5 g

3-Ethylsalicylaldehyde

Sign In for Pricing
View Details
ATP5MJ Human Gene Knockout Kit (CRISPR)
KN401346 1 Kit

ATP5MJ Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NBPF5 (NBPF5P) (C-term) Rabbit Polyclonal Antibody
AP52819PU-N 400 µL

NBPF5 (NBPF5P) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human TCP10L2 activation kit by CRISPRa
GA118322 1 Kit

Human TCP10L2 activation kit by CRISPRa

Sign In for Pricing
View Details
APH1A (NM_016022) Human Over-expression Lysate
LC402487 20 µg

APH1A (NM_016022) Human Over-expression Lysate

Sign In for Pricing
View Details