Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas stutzeri Protease HtpX (htpX)

This Recombinant Pseudomonas stutzeri Protease HtpX (htpX) spans the amino acid sequence from region 1-290.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

A4VMI8

Expression Region

1-290

Origin

Pseudomonas stutzeri (strain A1501)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMRIFLFLATNLAVLVIASITLKLLGVDRYTGQNYGSLLVFCAVFGFAGSLISLFISKWM AKMSTRTEIISQPRTRHEQWLLQTVEQLSREAGIKMPEVGIFPAYEANAFATGWNRNDAL VAVSQGLLERFSPDEVRAVLAHEIGHVANGDMVTLALIQGVVNTFVMFFARIFGNFVDKA ILKNEDGHGIGYFVATIFAELVLGILASIIVMWFSRKREYRADEAGAQLAGTSAMIGALQ RLRAEQGLPVHMPDSLKAFGINGSLKHGMAGLFMTHPSLEDRIEALRQRG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AMHR2 (N-term) Rabbit Polyclonal Antibody
AP13725PU-N 400 µL

AMHR2 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF740 conjugate, 0.1mg/mL
BNC740806-100 1x 100 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
2-Benzylideneheptanal-D₅, (contains E-isomer) (>85%)
TRC-B280040-2.5MG 2.5 mg

2-Benzylideneheptanal-D₅, (contains E-isomer) (>85%)

Sign In for Pricing
View Details
PPP1CA Rabbit Polyclonal Antibody
HA500074 100 µL

PPP1CA Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mix-n-StainTM Cyanine 555 Antibody Labeling Kit, 1x (50-100ug) labeling
#92414 1 Kit

Mix-n-StainTM Cyanine 555 Antibody Labeling Kit, 1x (50-100ug) labeling

Sign In for Pricing
View Details
LCOR Mouse Monoclonal Antibody [Clone ID: OTI3D10]
CF808021 100 µg

LCOR Mouse Monoclonal Antibody [Clone ID: OTI3D10]

Sign In for Pricing
View Details