Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Janthinobacterium sp. Protease HtpX homolog (htpX)

This Recombinant Janthinobacterium sp. Protease HtpX homolog (htpX) spans the amino acid sequence from region 1-290.

Product Specifications

Product Name Alternative

Protease HtpX homolog, EC= 3.4.24.-

UniProt

A6SXH1

Expression Region

1-290

Origin

Janthinobacterium sp. (strain Marseille) (Minibacterium massiliensis)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKRIFLFIATNIAVIAVMSVVLSLLGVDRFISQAGLNLPMLLVFSLVVGFTGSIISLLIS KPMAKWSTGARVIDAPSSSTELWLIDTVSKLAQRAGIKMPEVAVYDGEPNAFATGAFRDS ALVAVSTGLLQSMTKDEVEAVLAHEVAHVANGDMVTMTLVQGVVNTFVVFLSRVVGYFVD RAISRDNNNSQGIGYTITVIVSQIVFGIAASVIVAWFSRHREFRADAGAAKLLGSPQPMM KALARLGGIEPTSLPEGLASLGINDKPGFAALFSSHPPIEDRIAALRSLQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SSH3BP1 (ABI1) (NM_001178116) Human Over-expression Lysate
LC433176 20 µg

SSH3BP1 (ABI1) (NM_001178116) Human Over-expression Lysate

Sign In for Pricing
View Details
APC Anti-Human CD83 Antibody[HB15e]
E-AB-F0993E-01 20 Tests

APC Anti-Human CD83 Antibody[HB15e]

Sign In for Pricing
View Details
APC Anti-Human CD83 Antibody[HB15e]
E-AB-F0993E-02 100 Tests

APC Anti-Human CD83 Antibody[HB15e]

Sign In for Pricing
View Details
APC Anti-Human CD83 Antibody[HB15e]
E-AB-F0993E-03 2x 100 Tests

APC Anti-Human CD83 Antibody[HB15e]

Sign In for Pricing
View Details
IGFBP1 Mouse Monoclonal Antibody [Clone ID: OTI4E12]
CF808670 100 µg

IGFBP1 Mouse Monoclonal Antibody [Clone ID: OTI4E12]

Sign In for Pricing
View Details
ADH1B (NM_000668) Human Over-expression Lysate
LY424580 100 µg

ADH1B (NM_000668) Human Over-expression Lysate

Sign In for Pricing
View Details