Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Janthinobacterium sp. Protease HtpX homolog (htpX)

This Recombinant Janthinobacterium sp. Protease HtpX homolog (htpX) spans the amino acid sequence from region 1-290.

Product Specifications

Product Name Alternative

Protease HtpX homolog, EC= 3.4.24.-

UniProt

A6SXH1

Expression Region

1-290

Origin

Janthinobacterium sp. (strain Marseille) (Minibacterium massiliensis)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKRIFLFIATNIAVIAVMSVVLSLLGVDRFISQAGLNLPMLLVFSLVVGFTGSIISLLIS KPMAKWSTGARVIDAPSSSTELWLIDTVSKLAQRAGIKMPEVAVYDGEPNAFATGAFRDS ALVAVSTGLLQSMTKDEVEAVLAHEVAHVANGDMVTMTLVQGVVNTFVVFLSRVVGYFVD RAISRDNNNSQGIGYTITVIVSQIVFGIAASVIVAWFSRHREFRADAGAAKLLGSPQPMM KALARLGGIEPTSLPEGLASLGINDKPGFAALFSSHPPIEDRIAALRSLQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

JNK1 (MAPK8) Human Knockdown Lysate
LY300236 100 µg

JNK1 (MAPK8) Human Knockdown Lysate

Sign In for Pricing
View Details
GATA1 Rabbit Polyclonal Antibody
AP06135PU-N 100 µg

GATA1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary: right
CS502086 5x 5 µm

Frozen Tissue Sections, Ovary: right

Sign In for Pricing
View Details
Human MCP-1 Antibody Pair Set
E-KAB-0052 50 µL & 100 µg

Human MCP-1 Antibody Pair Set

Sign In for Pricing
View Details
C21orf7 (MAP3K7CL) (NM_001286624) Human Tagged ORF Clone
RG235538 10 µg

C21orf7 (MAP3K7CL) (NM_001286624) Human Tagged ORF Clone

Sign In for Pricing
View Details
(3S,4aS,8aS)-2-Carbobenzyloxy-decahydro-3-isoquinolinecarboxylic Acid
TRC-C176455-50MG 50 mg

(3S,4aS,8aS)-2-Carbobenzyloxy-decahydro-3-isoquinolinecarboxylic Acid

Sign In for Pricing
View Details