Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Archaeoglobus fulgidus Probable cobalamin biosynthesis protein CobD (cobD)

This Recombinant Archaeoglobus fulgidus Probable cobalamin biosynthesis protein CobD (cobD) spans the amino acid sequence from region 1-290.

Product Specifications

Product Name Alternative

Probable cobalamin biosynthesis protein CobD

UniProt

O28933

Expression Region

1-290

Origin

Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGIEVVVLLTTLMLDAAVGEPPALLHPVVWYGKLISLLERAKFRKMLVEIFYGAFCCLIV ITFALILSLLPFPYPLNFLWAVYLLFSSISVKSMVNHARVCVESGVDRKAVQMIVSRNTE ELSEEQLCSAVIESVAENYVDGVVAPLFYFSIFGVAGAVVYRAVNTCDAMVGYRKGRYEA FGKFAARLDDILNYIPARLSLLFFELLKRGAFSYGLKRNVKLNGCAIAAMSYLLGVKLEK PGYYSLPGIEPSAADIERAIKAFVRLTVIAVIFTTIAVSIRIVLLTKLHF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IgG Immunoglobulin (IG266), CF647 conjugate, 0.1mg/mL
BNC470266-500 1x 500 µL

Human IgG Immunoglobulin (IG266), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF405S conjugate, 0.1mg/mL
BNC040460-100 1x 100 µL

CD44 Standard (156-3C11), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF740 conjugate, 0.1mg/mL
BNC740679-100 1x 100 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF568 conjugate, 0.1mg/mL
BNC680305-500 1x 500 µL

CD95 (B-R18), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF640R conjugate, 0.1mg/mL
BNC400257-100 1x 100 µL

Cytokeratin, HMW (AE-3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
VEGI (Vascular Endothelial Growth Inhibitor) (VEGI/1283), CF740 conjugate, 0.1mg/mL
BNC741283-500 1x 500 µL

VEGI (Vascular Endothelial Growth Inhibitor) (VEGI/1283), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details