Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pyrococcus kodakaraensis Protease HtpX homolog (htpX)

This Recombinant Pyrococcus kodakaraensis Protease HtpX homolog (htpX) spans the amino acid sequence from region 1-290.

Product Specifications

Product Name Alternative

Protease HtpX homolog, EC= 3.4.24.-

UniProt

Q5JEZ8

Expression Region

1-290

Origin

Pyrococcus kodakaraensis (strain ATCC BAA-918 / JCM 12380 / KOD1) (Thermococcus kodakaraensis (strain KOD1) )

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGLVMWLRTGVLMAILTGLLMGIGYLFGGPNVAFIMFLFSMFFNFITYWYSDRIVLSWYN ARIVDEYEAPELYAIVRDLAQRAGLPTPRVAIIPSETPNAFATGRDPKHAVVAVTQGLLR ILNRDELEGVIGHELTHIKNRDILIGTVAAAMAGAIMQLAYWARWIAIFGGFNRDRDDGG DIIGAILVAILAPIAAMLIQAAISRSREFLADEGGARISGKPHALASALMKIEQAVNYRP MREGNPATAHMFIVNPFRGMSIANLFSTHPPTEARIERLRKIAEEMGIYF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD4 (EDU-2), CF647 conjugate, 0.1mg/mL
BNC470345-100 1x 100 µL

CD4 (EDU-2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF405S conjugate, 0.1mg/mL
BNC041052-100 1x 100 µL

CD3e (B-B12), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RB (PD7/26), CF568 conjugate, 0.1mg/mL
BNC680472-100 1x 100 µL

CD45RB (PD7/26), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD6 (C6/372), CF740 conjugate, 0.1mg/mL
BNC740372-500 1x 500 µL

CD6 (C6/372), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (MUC5AC/917), CF488A conjugate, 0.1mg/mL
BNC880917-100 1x 100 µL

Mucin 5AC (MUC5AC) (MUC5AC/917), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD19 (CVID3/429), CF488A conjugate, 0.1mg/mL
BNC880429-500 1x 500 µL

CD19 (CVID3/429), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details