Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Protein orai-3 (Orai3)

This Recombinant Rat Protein orai-3 (Orai3) spans the amino acid sequence from region 1-290.

Product Specifications

Product Name Alternative

Protein orai-3, Transmembrane protein 142C

UniProt

Q6AXR8

Expression Region

1-290

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKGGEGDTGEQAPLNPEVDSPAGSATYREFVHRGYLDLMGASQHSLRALSWRRLYLSRAK LKASSRTSALLSGFAMVAMVEVQLESDHEYPPGLLVAFSACTTVLVAVHLFALMVSTCLL PHIEAVSNIHNLNSVHQSPHQRLHRYVELAWGFSTALGTFLFLAEVVLVGWVKFVPIGAP MDKPAPVVPMSQVPPVTVSLSLASNLTPSSASVATTQQPPKACPPRQVCGSAHGPGWQAA MASTAIMVPVGLVFMAFALHFYRSLVAHKTDRHKQELEELSRLQGELQAV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GMFG Polyclonal Antibody
E-AB-10913-01 20 µL

GMFG Polyclonal Antibody

Sign In for Pricing
View Details
GMFG Polyclonal Antibody
E-AB-10913-02 60 µL

GMFG Polyclonal Antibody

Sign In for Pricing
View Details
GMFG Polyclonal Antibody
E-AB-10913-03 120 µL

GMFG Polyclonal Antibody

Sign In for Pricing
View Details
GMFG Polyclonal Antibody
E-AB-10913-04 200 µL

GMFG Polyclonal Antibody

Sign In for Pricing
View Details
Neurofilament (NEFL) Rabbit Polyclonal Antibody
TA379041 100 µL

Neurofilament (NEFL) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Slc25a47 Mouse Gene Knockout Kit (CRISPR)
KN515995 1 Kit

Slc25a47 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details