Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Outer dense fiber protein 4 (Odf4)

This Recombinant Rat Outer dense fiber protein 4 (Odf4) spans the amino acid sequence from region 1-290.

Product Specifications

Product Name Alternative

Outer dense fiber protein 4, Outer dense fiber of sperm tails protein 4

UniProt

Q6AXT9

Expression Region

1-290

Origin

Rattus norvegicus (Rat)

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MESDLTVEESETIKTRSRRPLTEHRRHSLLPLQWKLAHSSRWMAQVVASEFSLLAFLLLL LMVFSKKWLYPSKSRFHQRYPQNITKRVYTSIHSMSTGLLYICISKSCLSSDNEEDNFKM WTIHPAFGVAKISFILAVGLGFVLTVWLHLPYLPCLQRMPFFGLIGIILSFCEVTLIFLT LLLFPVNLWIYELKKNISVPIGWSYFIGWLVLILYLTCGILCYLNHKNFWSLIMSSSSIN ATCSSSVPVSLMNTSQISKSQADILDPTQDDQKPLSSDNIALPPNPDTTD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant FOXP3 Antibody
RC-15509-01 50 μL

Recombinant FOXP3 Antibody

Sign In for Pricing
View Details
Recombinant FOXP3 Antibody
RC-15509-02 100 µL

Recombinant FOXP3 Antibody

Sign In for Pricing
View Details
Recombinant FOXP3 Antibody
RC-15509-03 1 mL

Recombinant FOXP3 Antibody

Sign In for Pricing
View Details
CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (CFTR/2290R), CF488A conjugate, 0.1mg/mL
BNC882290-500 1x 500 µL

CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (CFTR/2290R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ube2d3 Mouse Gene Knockout Kit (CRISPR)
KN518568 1 Kit

Ube2d3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Linoleoyl Carnitine
TRC-L468200-10MG 10 mg

Linoleoyl Carnitine

Sign In for Pricing
View Details