Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Outer dense fiber protein 4 (Odf4)

This Recombinant Rat Outer dense fiber protein 4 (Odf4) spans the amino acid sequence from region 1-290.

Product Specifications

Product Name Alternative

Outer dense fiber protein 4, Outer dense fiber of sperm tails protein 4

UniProt

Q6AXT9

Expression Region

1-290

Origin

Rattus norvegicus (Rat)

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MESDLTVEESETIKTRSRRPLTEHRRHSLLPLQWKLAHSSRWMAQVVASEFSLLAFLLLL LMVFSKKWLYPSKSRFHQRYPQNITKRVYTSIHSMSTGLLYICISKSCLSSDNEEDNFKM WTIHPAFGVAKISFILAVGLGFVLTVWLHLPYLPCLQRMPFFGLIGIILSFCEVTLIFLT LLLFPVNLWIYELKKNISVPIGWSYFIGWLVLILYLTCGILCYLNHKNFWSLIMSSSSIN ATCSSSVPVSLMNTSQISKSQADILDPTQDDQKPLSSDNIALPPNPDTTD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Laminin alpha 4 (LAMA4) Mouse Monoclonal Antibody [Clone ID: 6C3]
AM26108PU-N 100 µg

Laminin alpha 4 (LAMA4) Mouse Monoclonal Antibody [Clone ID: 6C3]

Sign In for Pricing
View Details
(2R,3R)-3-Hydroxynorleucine
TRC-H949750-250MG 250 mg

(2R,3R)-3-Hydroxynorleucine

Sign In for Pricing
View Details
HER-4 / ERBB4 (HFR-1), CF488A conjugate, 0.1mg/mL
BNC882379-100 1x 100 µL

HER-4 / ERBB4 (HFR-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Mouse IgG3, κ Isotype Control[A112-3]
E-AB-F09752Q-01 20 Tests

Elab Fluor® Violet 450 Mouse IgG3, κ Isotype Control[A112-3]

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Mouse IgG3, κ Isotype Control[A112-3]
E-AB-F09752Q-02 100 Tests

Elab Fluor® Violet 450 Mouse IgG3, κ Isotype Control[A112-3]

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Mouse IgG3, κ Isotype Control[A112-3]
E-AB-F09752Q-03 2x 100 Tests

Elab Fluor® Violet 450 Mouse IgG3, κ Isotype Control[A112-3]

Sign In for Pricing
View Details