Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Outer dense fiber protein 4 (Odf4)

This Recombinant Rat Outer dense fiber protein 4 (Odf4) spans the amino acid sequence from region 1-290.

Product Specifications

Product Name Alternative

Outer dense fiber protein 4, Outer dense fiber of sperm tails protein 4

UniProt

Q6AXT9

Expression Region

1-290

Origin

Rattus norvegicus (Rat)

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MESDLTVEESETIKTRSRRPLTEHRRHSLLPLQWKLAHSSRWMAQVVASEFSLLAFLLLL LMVFSKKWLYPSKSRFHQRYPQNITKRVYTSIHSMSTGLLYICISKSCLSSDNEEDNFKM WTIHPAFGVAKISFILAVGLGFVLTVWLHLPYLPCLQRMPFFGLIGIILSFCEVTLIFLT LLLFPVNLWIYELKKNISVPIGWSYFIGWLVLILYLTCGILCYLNHKNFWSLIMSSSSIN ATCSSSVPVSLMNTSQISKSQADILDPTQDDQKPLSSDNIALPPNPDTTD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P40 (deltaNp63) (Squamous, Basal & Myoepithelial Cell Marker), CF405S conjugate, 0.1mg/mL
BNC042314-100 1x 100 µL

P40 (deltaNp63) (Squamous, Basal & Myoepithelial Cell Marker), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Angiotensin II Type 1 Receptor (AGTR1) Rabbit Polyclonal Antibody
AP23488PU-N 50 µg

Angiotensin II Type 1 Receptor (AGTR1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Laminin (A5), CF405S conjugate, 0.1mg/mL
BNC040308-100 1x 100 µL

Laminin (A5), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
N-Nitroso Vortioxetine
TRC-N620560-50MG 50 mg

N-Nitroso Vortioxetine

Sign In for Pricing
View Details
TFIIB (GTF2B) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2A1]
TA808572BM 100 µL

TFIIB (GTF2B) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2A1]

Sign In for Pricing
View Details
VEGFB Antibody
8C0389-AAT 50 µg

VEGFB Antibody

Sign In for Pricing
View Details