Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Protein orai-3 (Orai3)

This Recombinant Mouse Protein orai-3 (Orai3) spans the amino acid sequence from region 1-290.

Product Specifications

Product Name Alternative

Protein orai-3, Transmembrane protein 142C

UniProt

Q6P8G8

Expression Region

1-290

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKGGEGDTGEQAPLNPEVDSPAGSATYREFVHRGYLDLMGASQHSLRALSWRRLYLSRAK LKASSRTSALLSGFAMVAMVEVQLENDHEYPPGLLVAFSACTTVLVAVHLFALMVSTCLL PHIEAVSNIHNLNSVHQSPHQRLHRYVELAWGFSTALGTFLFLAEVVLVGWVKFVPIGAP MGKPAPVVPMSQVPPVTVSLSLASNLTPSSASITTSQQPSKACPPRQVCDSAHGPGWQAA MASTAIMVPVGLVFMAFALHFYRSLVAHKTDRHKQELEELSRLQGELQAV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SFTA3 (NM_001101341) Human Over-expression Lysate
LC426141 20 µg

SFTA3 (NM_001101341) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Tcl1 activation kit by CRISPRa
GA204254 1 Kit

Mouse Tcl1 activation kit by CRISPRa

Sign In for Pricing
View Details
Protein Tyrosine Phosphatase, non-receptor type 6 (CPTC-PTPN6-2), CF488A conjugate, 0.1mg/mL
BNC882259-100 1x 100 µL

Protein Tyrosine Phosphatase, non-receptor type 6 (CPTC-PTPN6-2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ALLC Human Gene Knockout Kit (CRISPR)
KN416471 1 Kit

ALLC Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GCAP1 (GUCA1A) (NM_000409) Human Over-expression Lysate
LY424724 100 µg

GCAP1 (GUCA1A) (NM_000409) Human Over-expression Lysate

Sign In for Pricing
View Details
Thymosin beta 4 (TMSB4X) (1-14) Rabbit Polyclonal Antibody
AP02233SU-N 100 µL

Thymosin beta 4 (TMSB4X) (1-14) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details