Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Protein orai-3 (Orai3)

This Recombinant Mouse Protein orai-3 (Orai3) spans the amino acid sequence from region 1-290.

Product Specifications

Product Name Alternative

Protein orai-3, Transmembrane protein 142C

UniProt

Q6P8G8

Expression Region

1-290

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKGGEGDTGEQAPLNPEVDSPAGSATYREFVHRGYLDLMGASQHSLRALSWRRLYLSRAK LKASSRTSALLSGFAMVAMVEVQLENDHEYPPGLLVAFSACTTVLVAVHLFALMVSTCLL PHIEAVSNIHNLNSVHQSPHQRLHRYVELAWGFSTALGTFLFLAEVVLVGWVKFVPIGAP MGKPAPVVPMSQVPPVTVSLSLASNLTPSSASITTSQQPSKACPPRQVCDSAHGPGWQAA MASTAIMVPVGLVFMAFALHFYRSLVAHKTDRHKQELEELSRLQGELQAV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glucose 6 phosphate isomerase (GPI) Mouse Monoclonal Antibody [Clone ID: 1B7D7]
AM06224SU-N 100 µL

Glucose 6 phosphate isomerase (GPI) Mouse Monoclonal Antibody [Clone ID: 1B7D7]

Sign In for Pricing
View Details
Cardboard Freezer Boxes
R2700-P 5 Units/Pack

Cardboard Freezer Boxes

Sign In for Pricing
View Details
Rac 3-(1,2,4-Triazol-1-yl)-L-alanine-15N,d2 Hydrochloride (d3 major)
TRC-T767518-5MG 5 mg

Rac 3-(1,2,4-Triazol-1-yl)-L-alanine-15N,d2 Hydrochloride (d3 major)

Sign In for Pricing
View Details
Parp2 (C-term) Rabbit Polyclonal Antibody
AP53164PU-N 400 µL

Parp2 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ttc36 Mouse Gene Knockout Kit (CRISPR)
KN518417 1 Kit

Ttc36 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Glucocorticoid Receptor alpha Mouse Monoclonal Antibody [3F2]
EM1701-66 100 µL

Glucocorticoid Receptor alpha Mouse Monoclonal Antibody [3F2]

Sign In for Pricing
View Details