Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pyrococcus abyssi Probable cobalamin biosynthesis protein CobD (cobD)

This Recombinant Pyrococcus abyssi Probable cobalamin biosynthesis protein CobD (cobD) spans the amino acid sequence from region 1-290.

Product Specifications

Product Name Alternative

Probable cobalamin biosynthesis protein CobD

UniProt

Q9V2M8

Expression Region

1-290

Origin

Pyrococcus abyssi (strain GE5 / Orsay)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPLILLGLALIWDLLLGEPPAKIHPVVWFGKIAGFLDNRWRRRGKIGFLAGAFVTFIIV ALAFFLSLIPSYLTFPLDYLLAIYLLKSSFAIRSLYEHVARTVTEDIEEKRKTVSMIVSR DVKVLDLAHLNSAAIESLAENLNDSVVAPLFYFMLFGLPGAMVYRAVNTLDAMFGYRDER YEYFGKFPARLDDILNFIPARLTVLLYLPFGVKVLKYYKLARFKINSDKPIAAMSAVLGV WLEKPGAYRFPGREPRDEDIKRALDVYKLVVAEYLSIVFVLKVVQLCLNP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Moesin (MSN/491), CF640R conjugate, 0.1mg/mL
BNC400491-500 1x 500 µL

Moesin (MSN/491), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MHC II, Mouse (MK-D6), CF568 conjugate, 0.1mg/mL
BNC682007-500 1x 500 µL

MHC II, Mouse (MK-D6), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Prealbumin (TTR) Mouse Monoclonal Antibody [Clone ID: OTI1A10]
CF816356 100 µL

Prealbumin (TTR) Mouse Monoclonal Antibody [Clone ID: OTI1A10]

Sign In for Pricing
View Details
PTEN (Tumor Suppressor Oncoprotein) (PTEN/2110), CF488A conjugate, 0.1mg/mL
BNC882110-100 1x 100 µL

PTEN (Tumor Suppressor Oncoprotein) (PTEN/2110), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cantharidin
SIH-519-100MG 100 mg

Cantharidin

Sign In for Pricing
View Details
IL6 Rabbit Polyclonal Antibody
TA384528 100 µL

IL6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details