Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas aeruginosa Protease HtpX (htpX)

This Recombinant Pseudomonas aeruginosa Protease HtpX (htpX) spans the amino acid sequence from region 1-291.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

A6V3R0

Expression Region

1-291

Origin

Pseudomonas aeruginosa (strain PA7)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMRILLFLATNLAVLVIASITLKLLGVDRFTGQNYGSLLVFCAVFGFAGSLVSLFISKWM AKMSTGTEVISQPRTRHEQWLLQTVEELSREAGIKMPEVGIFPAYEANAFATGWNKNDAL VAVSQGLLERFSPDEVKAVLAHEIGHVANGDMVTLALIQGVVNTFVMFFARIFGNFVDKA ILKNEDGPGIGYFVATIFAELVLGILASIIVMWFSRRREFRADAAGAHLAGTGAMIAALQ RLRSEQGVPVQMPDTLNAFGINGGLKHGLAGLLMSHPPLEDRIEALRASAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P53 (PAb122), CF568 conjugate, 0.1mg/mL
BNC680338-500 1x 500 µL

P53 (PAb122), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF740 conjugate, 0.1mg/mL
BNC740745-100 1x 100 µL

CD45 / LCA (2B11 + PD7/26), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 1 (Suprabasal Keratinocyte Marker) (LHK1), CF594 conjugate, 0.1mg/mL
BNC941660-500 1x 500 µL

Cytokeratin 1 (Suprabasal Keratinocyte Marker) (LHK1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TTF-1 / NKX2.1 (8G7G3/1 + NX2.1/690), CF568 conjugate, 0.1mg/mL
BNC680907-500 1x 500 µL

TTF-1 / NKX2.1 (8G7G3/1 + NX2.1/690), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PAX6 (PAX6/498), CF405S conjugate, 0.1mg/mL
BNC040498-500 1x 500 µL

PAX6 (PAX6/498), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF568 conjugate, 0.1mg/mL
BNC681073-100 1x 100 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details