Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Leptothrix cholodnii Protease HtpX homolog (htpX)

This Recombinant Leptothrix cholodnii Protease HtpX homolog (htpX) spans the amino acid sequence from region 1-291.

Product Specifications

Product Name Alternative

Protease HtpX homolog, EC= 3.4.24.-

UniProt

B1XWS3

Expression Region

1-291

Origin

Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) (Leptothrix discophora (strain SP-6) )

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKRIALFLITNLAVMAVLGITASLLGFNRYYAATGLDLGALLGFAMVMGFGGAFISLLMS KPMAKWSTGAVVINDSPEPMHRWLVDTVARFSKRAGIEMPEVALYEGEPNAFATGAFKNS ALVAVSTGLLQSMSRDEVEAVIGHEVAHVANGDMVTMTLIQGVMNTFVVFLSRAIGYFID RVVLKNDREGPGIGYMVTTVVLDLLLGLVAAMIVAWFSRQREFRADAGAAQLMGSRVPMQ RALARLGGIDPGELPQSVATMGINGRPSGIMALFSSHPPIEDRIRALQQSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 5AC (MUC5AC) (45M1), CF568 conjugate, 0.1mg/mL
BNC680031-500 1x 500 µL

Mucin 5AC (MUC5AC) (45M1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF594 conjugate, 0.1mg/mL
BNC941429-100 1x 100 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF740 conjugate, 0.1mg/mL
BNC740218-100 1x 100 µL

CD100 (Semaphorin-4D) (A8), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (PAb122), CF740 conjugate, 0.1mg/mL
BNC740338-500 1x 500 µL

P53 (PAb122), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF594 conjugate, 0.1mg/mL
BNC940009-100 1x 100 µL

MART-1 / Melan-A (M2-7C10), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF640R conjugate, 0.1mg/mL
BNC401037-500 1x 500 µL

CD44 Standard (DF1485), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details