Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Trimeric intracellular cation channel type B (TMEM38B)

This Recombinant Bovine Trimeric intracellular cation channel type B (TMEM38B) spans the amino acid sequence from region 1-291.

Product Specifications

Product Name Alternative

Trimeric intracellular cation channel type B, TRIC-B, TRICB, Transmembrane protein 38B

UniProt

Q0VC58

Expression Region

1-291

Origin

Bos taurus (Bovine)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MESPWNELTLAFSRTSMFPFFDIAHYLVSVMALKHQPGAAALAWKNPLSSWFTAMLHCFG GGILSCVLLAEPPLRFLANNTNILLASSIWYIAFFCPCDLISQAYSFLPVQLLAAGMKEV TRTWKIVGGVTHANSYYKNGWIVMIAVGWARGAGGSIITNFEQLVKGCWKPEAEEWLKMS YPAKVTLLGSVIFTFQQTKYLAISKHNLMFLFTVFLVATKITMMITKTALVPFACFEDTL SRMLFGWQQQFSPCEKKSETKSSFNGTGSSTSKPVANASDKVKKKHSKKTE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (RIV9), CF594 conjugate, 0.1mg/mL
BNC940322-100 1x 100 µL

CD3e (RIV9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (T311), CF488A conjugate, 0.1mg/mL
BNC880012-500 1x 500 µL

Tyrosinase (T311), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF488A conjugate, 0.1mg/mL
BNC880189-100 1x 100 µL

CD74 (BU45), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF640R conjugate, 0.1mg/mL
BNC400017-500 1x 500 µL

Ep-CAM / CD326 (VU-1D9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD62L (L-Selectin) (LAM1-116), CF405S conjugate, 0.1mg/mL
BNC041587-100 1x 100 µL

CD62L (L-Selectin) (LAM1-116), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cadherin 17 / LI Cadherin (Liver-Intestine Marker) (CDH17/2616), CF640R conjugate, 0.1mg/mL
BNC402616-500 1x 500 µL

Cadherin 17 / LI Cadherin (Liver-Intestine Marker) (CDH17/2616), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details