Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protease HtpX (htpX)

This Recombinant Protease HtpX (htpX) spans the amino acid sequence from region 1-291.

Product Specifications

Product Name Alternative

Protease HtpX, EC= 3.4.24.-, Heat shock protein HtpX

UniProt

Q1LTF8

Expression Region

1-291

Origin

Baumannia cicadellinicola subsp. Homalodisca coagulata

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMRIVIFLLTNLAVMVVFGILLTCVGTHSSNTVRLMIISGLFGFCGAFISLLMSKFIALR SVGGKVISQPQNETEHWLLNIILNQAQKIGITMPQVAIYNAPDMNAFATGPSRNNSLVAV STGLLQNMPRTEIEAVIAHEISHISNGDMVTITLISGIVNTFVIFISRFLAQLTAGFIGS NNEESNNGNKLVYMIVSTILELAFGILASIIVLWFSRYREFYADAGSANIVGCDKMIAAL QRLKTSYEPKVTNNIKIFCINGYQKSLSEFFMSHPPLNKRIEALRYGTYMK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CTLA4 (Cytotoxic T-lymphocyte protein 4) ELISA Kit
MBS7617990-01 48 Well

Human CTLA4 (Cytotoxic T-lymphocyte protein 4) ELISA Kit

Sign In for Pricing
View Details
Human CTLA4 (Cytotoxic T-lymphocyte protein 4) ELISA Kit
MBS7617990-02 96 Well

Human CTLA4 (Cytotoxic T-lymphocyte protein 4) ELISA Kit

Sign In for Pricing
View Details
Human CTLA4 (Cytotoxic T-lymphocyte protein 4) ELISA Kit
MBS7617990-03 5x 96 Well

Human CTLA4 (Cytotoxic T-lymphocyte protein 4) ELISA Kit

Sign In for Pricing
View Details
Human CTLA4 (Cytotoxic T-lymphocyte protein 4) ELISA Kit
MBS7617990-04 10x 96 Well

Human CTLA4 (Cytotoxic T-lymphocyte protein 4) ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal MFAP4 Antibody [Alexa Fluor 700]
NBP2-97485AF700 0.1 mL

Rabbit Polyclonal MFAP4 Antibody [Alexa Fluor 700]

Sign In for Pricing
View Details
1-Adamantaneethanol
408705-01 5 g

1-Adamantaneethanol

Sign In for Pricing
View Details