Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acinetobacter sp. ATP synthase subunit a (atpB)

This Recombinant Acinetobacter sp. ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-291.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q6FFK6

Expression Region

1-291

Origin

Acinetobacter sp. (strain ADP1)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAEEHALTSTEYIKHHLTNLTYGKMPDGTWKLAENAKEAQEMGFSAIHLDSMGWSIGLG IIFCLVFWCAAKAAKADVPSKFQSAIEMIIEFVDSSVRDTFHGKSRLIAPLALTIFVWIF LMNLMDLIPVDWVPMLAQIVGAHVFGMDPHHVYFKIVPSTDPNITLGMSLSVFVLILFYS IREKGIGGFVGELALNPFNPSNPVAKALLIPVNLILELVTFLARPISLALRLFGNMYAGE LIFILIALLPFWIQWALSVPWAIFHILVITLQAFIFMMLTIVYLSMASEKH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNAJC25 Protein Vector (Mouse) (pPB-N-His)
PV172779 500 ng

DNAJC25 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
SDHD Polyclonal Antibody, PerCP-Cy5.5 Conjugated
bs-3971R-PerCP-Cy5.5 100 µL

SDHD Polyclonal Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details
Recombinant Human SEC13 Protein, His, E.coli-5ug
QP13445-5ug 5ug

Recombinant Human SEC13 Protein, His, E.coli-5ug

Sign In for Pricing
View Details
RFXANK Antibody
orb1322219 100 µL

RFXANK Antibody

Sign In for Pricing
View Details
CARM1 (Ab-228) Antibody
CSB-PA021890 100 µL

CARM1 (Ab-228) Antibody

Sign In for Pricing
View Details
TMEM107 Antibody
7483-002mg 0.02 mg

TMEM107 Antibody

Sign In for Pricing
View Details